Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PIP4P2
Gene Name  | PIP4P2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PIP4P2 , TMEM55A | |
| Protein Name | PIP4P2 |
|
| Alternative Name(s) |
Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase;Type 2 PtdIns-4,5-P2 4-Ptase;3.1.3.78;PtdIns-4,5-P2 4-Ptase II;Transmembrane protein 55A; | |
| EntrezGene ID | 55529 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q8N4L2 (protein sequence) | |
| Enzyme Class | EC 3.1.3.78 (BRENDA ) | |
| Molecular Weight | 28081 Dalton | |
| Protein Length | 257 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000155099 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Inositol 4,5-bisphosphate 4-phosphatase | CATH ID: NA | SCOP Fold: TMEM55 | |
| Phosphatase activity | active | Catalytic signature motif: ICKDTSRR | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Late endosome membrane Lysosome membrane | |||
| Function (UniProt annotation) | |||
| Catalyzes the hydrolysis of the 4-position phosphate ofphosphatidylinositol 4,5-bisphosphate Does not hydrolyzephosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate,phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate | |||
| Catalytic Activity (UniProt annotation) | |||
| 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate+ phosphate | |||
| Protein Sequence | |||
| MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRVCQSLINLDGKLHQHVVKCTV CNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNT FLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAYITIGMICIFIGVGLTVGTPDFARRFRATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHSFA |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0005765 | C:lysosomal membrane |
| GO:0016021 | C:integral component of membrane |
| GO:0031902 | C:late endosome membrane |
| GO:0034597 | F:phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity |
| GO:0046856 | P:phosphatidylinositol dephosphorylation |