Top
MTMR10
Localization (UniProt annotation) N/A Function (UniProt annotation) Probable pseudophosphatase Contains a Glu residueinstead of a conserved Cys residue in the dsPTPase catalytic loopwhich renders it catalytically inactive as a phosphatase(Potential) Catalytic Activity (UniProt annotation) NA Protein Sequence MFSLKPPKPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTSQYDLWGKLICSNFKISFITD
DPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKVLGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVC
LAIAHYSQPTDLQLLFAFEYVGKKYHNSANKINGIPSGDGGGGGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASGWR
VCSINEGYMISTCLPEYIVVPSSLADQDLKIFSHSFVGRRMPLWCWSHSNGSALVRMALIKDVLQQRKIDQRICNAITKS
HPQRSDVYKSDLDKTLPNIQEVQAAFVKLKQLCVNEPFEETEEKWLSSLENTRWLEYVRAFLKHSAELVYMLESKHLSVV
LQEEEGRDLSCCVASLVQVMLDPYFRTITGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPAA
FEFSETYLAVLYDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWSLQFTAKDRTLFHNPFYIGK
STPCIQNGSVKSFKRTKKSYSSTLRGMPSALKNGIISDQELLPRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPAN
LHGVILPRVSGTHIKLWKLCYFRWVPEAQISLGGSITAFHKLSLLADEVDVLSRMLRQQRSGPLEACYGELGQSRMYFNA
SGPHHTDTSGTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1660516 Synthesis of PIPs at the early endosome membrane. At the early endosome membrane, phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) is generated in two steps from phosphatidylinositol 3,4-bisphosphate PI(3,4)P2 by the action of various kinases and phosphatases (Sbrissa et al. 2007, Sbrissa et al. 2008, Cao et al. 2007, Cao et al. 2008, Arcaro et al. 2000, Kim et al. 2002)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ERBB3 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID GADD45GIP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID IDE Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID LONP2 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MEOX2 Two-hybrid physical 24722188 , (Europe PMC )NA BioGRID MTM1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MTMR10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MTMR2 Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID NMNAT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NUDT16 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID OSGEP Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTK7 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID SMAD5 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD9 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53RK Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source SMAD5 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD9 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ERBB3 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID GADD45GIP1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID IDE Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID LONP2 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MEOX2 Two-hybrid physical 24722188 , (Europe PMC )NA BioGRID MTM1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MTMR10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MTMR2 Affinity Capture-MS physical 27432908 , 27880917 , (Europe PMC )NA BioGRID NMNAT1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NUDT16 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID OSGEP Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PSMB4 anti tag coimmunoprecipitation physical association 25416956 , (Europe PMC )0.40 IntAct PTK7 Two-hybrid physical 28065597 , (Europe PMC )NA BioGRID SMAD5 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD9 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53RK Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID