Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
MTM1
Gene Name  | MTM1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | MTM1, CG2 | |
| Protein Name | MTM1 |
|
| Alternative Name(s) |
Myotubularin;Phosphatidylinositol-3,5-bisphosphate 3-phosphatase;3.1.3.95;Phosphatidylinositol-3-phosphate phosphatase;3.1.3.64; | |
| EntrezGene ID | 4534 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q13496 (protein sequence) | |
| Enzyme Class | EC 3.1.3.95 3.1.3.64 (BRENDA ) | |
| Molecular Weight | 69932 Dalton | |
| Protein Length | 603 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000171100 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP --> Subfamily: Myotubularin | Historic class: Class I Cys-based PTPs --> VH1-like or DSPs --> Myotubularins | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCSDGWDR | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Cell membrane; Peripheral membraneprotein Cell projection, filopodium Cell projection, ruffle Late endosome Note=Localizes as a densecytoplasmic network Also localizes to the plasma membrane,including plasma membrane extensions such as filopodia andruffles Predominantly located in the cytoplasm followinginteraction with MTMR12 Recruited to the late endosome followingEGF stimulation | |||
| Function (UniProt annotation) | |||
| Lipid phosphatase which dephosphorylatesphosphatidylinositol 3-monophosphate (PI3P) andphosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) Has also beenshown to dephosphorylate phosphotyrosine- and phosphoserine-containing peptides Negatively regulates EGFR degradation throughregulation of EGFR trafficking from the late endosome to thelysosome Plays a role in vacuolar formation and morphologyRegulates desmin intermediate filament assembly and architecturePlays a role in mitochondrial morphology and positioning Requiredfor skeletal muscle maintenance but not for myogenesis | |||
| Catalytic Activity (UniProt annotation) | |||
| 1-phosphatidyl-1D-myo-inositol 3-phosphate +H(2)O = 1-phosphatidyl-1D-myo-inositol + phosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate+ phosphate | |||
| Protein Sequence | |||
| MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNYRLYLRSLETDSS LILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLPLFAFLNEEKFN VDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIV RCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANKATGGGYESDDAYHNAELFFLDIHNIHVMRES LKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQVADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSI EGFEILVQKEWISFGHKFASRIGHGDKNHTDADRSPIFLQFIDCVWQMSKQFPTAFEFNEQFLIIILDHLYSCRFGTFLF NCESARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMEL LALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001726 | C:ruffle |
| GO:0004438 | F:phosphatidylinositol-3-phosphatase activity |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005737 | C:cytoplasm |
| GO:0005770 | C:late endosome |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0006470 | P:protein dephosphorylation |
| GO:0006661 | P:phosphatidylinositol biosynthetic process |
| GO:0008333 | P:endosome to lysosome transport |
| GO:0015031 | P:protein transport |
| GO:0019215 | F:intermediate filament binding |
| GO:0030175 | C:filopodium |
| GO:0031674 | C:I band |
| GO:0032007 | P:negative regulation of TOR signaling |
| GO:0032435 | P:negative regulation of proteasomal ubiquitin-dependent protein catabolic process |
| GO:0035091 | F:phosphatidylinositol binding |
| GO:0044088 | P:regulation of vacuole organization |
| GO:0045109 | P:intermediate filament organization |
| GO:0046716 | P:muscle cell cellular homeostasis |
| GO:0046856 | P:phosphatidylinositol dephosphorylation |
| GO:0048311 | P:mitochondrion distribution |
| GO:0048633 | P:positive regulation of skeletal muscle tissue growth |
| GO:0051898 | P:negative regulation of protein kinase B signaling |
| GO:0052629 | F:phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity |
| GO:0070584 | P:mitochondrion morphogenesis |
| GO:1902902 | P:negative regulation of autophagosome assembly |
