- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
GAK
Gene Name  | GAK (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | GAK | |
| Protein Name | GAK |
|
| Alternative Name(s) |
Cyclin-G-associated kinase;2.7.11.1; | |
| EntrezGene ID | 2580 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O14976 (protein sequence) | |
| Enzyme Class | EC 2.7.11.1 (BRENDA ) | |
| Molecular Weight | 143191 Dalton | |
| Protein Length | 1311 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000178950 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP --> Subfamily: PTEN-like | Historic class: Class I Cys-based PTPs | CATH ID: NA | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCMDGRAA | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, perinuclear region Golgi apparatus, trans-Golginetwork Cell junction, focaladhesion Note=Localizes to theperinuclear area and to the trans-Golgi network Also seen on theplasma membrane, probably at focal adhesions | |||
| Function (UniProt annotation) | |||
| Associates with cyclin G and CDK5 Seems to act as anauxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells Expressionoscillates slightly during the cell cycle, peaking at G1 | |||
| Catalytic Activity (UniProt annotation) | |||
| ATP + a protein = ADP + a phosphoprotein | |||
| Protein Sequence | |||
| MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNR AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQ HMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAAR NVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSV ANYAKGDLDISYITSRIAVMSFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMC DMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDV LIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDSPPSSSADASRFLHTLDWQEE KEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEGQEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDG VDLLGLHSEVGAGPAVPPQACKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAW TETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQ TSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAPEQVKKHYRRAVLAVHPDKAA GQPYEQHAKMIFMELNDAWSEFENQGSRPLF |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004674 | F:protein serine/threonine kinase activity |
| GO:0005524 | F:ATP binding |
| GO:0005794 | C:Golgi apparatus |
| GO:0005829 | C:cytosol |
| GO:0005925 | C:focal adhesion |
| GO:0006898 | P:receptor-mediated endocytosis |
| GO:0007029 | P:endoplasmic reticulum organization |
| GO:0007030 | P:Golgi organization |
| GO:0007049 | P:cell cycle |
| GO:0010977 | P:negative regulation of neuron projection development |
| GO:0016020 | C:membrane |
| GO:0016191 | P:synaptic vesicle uncoating |
| GO:0030332 | F:cyclin binding |
| GO:0031982 | C:vesicle |
| GO:0034067 | P:protein localization to Golgi apparatus |
| GO:0043231 | C:intracellular membrane-bounded organelle |
| GO:0048471 | C:perinuclear region of cytoplasm |
| GO:0051085 | P:chaperone cofactor-dependent protein refolding |
| GO:0051087 | F:chaperone binding |
| GO:0061024 | P:membrane organization |
| GO:0072318 | P:clathrin coat disassembly |
| GO:0072583 | P:clathrin-dependent endocytosis |
| GO:0072659 | P:protein localization to plasma membrane |
| GO:0090160 | P:Golgi to lysosome transport |
| GO:0098793 | C:presynapse |
| GO:1905224 | P:clathrin-coated pit assembly |
[Feedback|Contribution]
[Feedback|Contribution]
[ Feedback|Contribution]
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-432722 | Golgi Associated Vesicle Biogenesis. | Proteins that have been synthesized, processed and sorted eventually reach the final steps of the secretory pathway. This pathway is responsible not only for proteins that are secreted from the cell but also enzymes and other resident proteins in the lumen of the ER, Golgi, and lysosomes as well as integral proteins transported in the vesicle membranes |
| R-HSA-8856828 | Clathrin-mediated endocytosis. | Clathrin-mediated endocytosis (CME) is one of a number of process that control the uptake of material from the plasma membrane, and leads to the formation of clathrin-coated vesicles (Pearse et al, 1975; reviewed in Robinson, 2015; McMahon and Boucrot, 2011; Kirchhausen et al, 2014). CME contributes to signal transduction by regulating the cell surface expression and signaling of receptor tyrosine kinases (RTKs) and G-protein coupled receptors (GPCRs). Most RTKs exhibit a robust increase in internalization rate after binding specific ligands; however, some RTKs may also exhibit significant ligand-independent internalization (reviewed in Goh and Sorkin, 2013). CME controls RTK and GPCR signaling by organizing signaling both within the plasma membrane and on endosomes (reviewed in Eichel et al, 2016; Garay et al, 2015; Vieira et al, 1996; Sorkin and von Zastrow, 2014; Di Fiori and von Zastrow, 2014; Barbieri et al, 2016). CME also contributes to the uptake of material such as metabolites, hormones and other proteins from the extracellular space, and regulates membrane composition by recycling membrane components and/or targeting them for degradation. Clathrin-mediated endocytosis involves initiation of clathrin-coated pit (CCP) formation, cargo selection, coat assembly and stabilization, membrane scission and vesicle uncoating. Although for simplicity in this pathway, the steps leading to a mature CCP are represented in a linear and temporally distinct fashion, the formation of a clathrin-coated vesicle is a highly heterogeneous process and clear temporal boundaries between these processes may not exist (see for instance Taylor et al, 2011; Antonescu et al, 2011; reviewed in Kirchhausen et al, 2014). Cargo selection in particular is a critical aspect of the formation of a mature and stable CCP, and many of the proteins involved in the initiation and maturation of a CCP contribute to cargo selection and are themselves stabilized upon incorporation of cargo into the nascent vesicle (reviewed in Kirchhausen et al, 2014; McMahon and Boucrot, 2011).Although the clathrin triskelion was identified early as a major component of the coated vesicles, clathrin does not bind directly to membranes or to the endocytosed cargo. Vesicle formation instead relies on many proteins and adaptors that can bind the plasma membrane and interact with cargo molecules. Cargo selection depends on the recognition of endocytic signals in cytoplasmic tails of the cargo proteins by adaptors that interact with components of the vesicle's inner coat. The classic adaptor for clathrin-coated vesicles is the tetrameric AP-2 complex, which along with clathrin was identified early as a major component of the coat. Some cargo indeed bind directly to AP-2, but subsequent work has revealed a large family of proteins collectively known as CLASPs (clathrin- associated sorting proteins) that mediate the recruitment of diverse cargo into the emerging clathrin-coated vesicles (reviewed in Traub and Bonifacino, 2013). Many of these CLASP proteins themselves interact with AP-2 and clathrin, coordinating cargo recruitment with coat formation (Schmid et al, 2006; Edeling et al, 2006; reviewed in Traub and Bonifacino, 2013; Kirchhausen et al, 2014). Initiation of CCP formation is also influenced by lipid composition, regulated by clathrin-associated phosphatases and kinases (reviewed in Picas et al, 2016). The plasma membrane is enriched in PI(4,5)P2. Many of the proteins involved in initiating clathrin-coated pit formation bind to PI(4,5)P2 and induce membrane curvature through their BAR domains (reviewed in McMahon and Boucrot, 2011; Daumke et al, 2014). Epsin also contributes to early membrane curvature through its Epsin N-terminal homology (ENTH) domain, which promotes membrane curvature by inserting into the lipid bilayer (Ford et al, 2002). Following initiation, some CCPs progress to formation of vesicles, while others undergo disassembly at the cell surface without producing vesicles (Ehrlich et al, 2004; Loerke et al, 2009; Loerke et al, 2011; Aguet et al, 2013; Taylor et al, 2011). The assembly and stabilization of nascent CCPs is regulated by several proteins and lipids (Mettlen et al, 2009; Antonescu et al, 2011).Maturation of the emerging clathrin-coated vesicle is accompanied by further changes in the lipid composition of the membrane and increased membrane curvature, promoted by the recruitment of N-BAR domain containing proteins (reviewed in Daumke et al, 2014; Ferguson and De Camilli, 2012; Picas et al, 2016). Some N-BAR domain containing proteins also contribute to the recruitment of the large GTPase dynamin, which is responsible for scission of the mature vesicle from the plasma membrane (Koh et al, 2007; Lundmark and Carlsson, 2003; Soulet et al, 2005; David et al, 1996; Owen et al, 1998; Shupliakov et al, 1997; Taylor et al, 2011; Ferguson et al, 2009; Aguet et al, 2013; Posor et al, 2013; Chappie et al, 2010; Shnyrova et al, 2013; reviewed in Mettlen et al, 2009; Daumke et al, 2014). After vesicle scission, the clathrin coat is dissociated from the new vesicle by the ATPase HSPA8 (also known as HSC70) and its DNAJ cofactor auxilin, priming the vesicle for fusion with a subsequent endocytic compartment and releasing clathrin for reuse (reviewed in McMahon and Boucrot, 2011; Sousa and Laufer, 2015) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTRT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AFAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ALK | Affinity Capture-MS | physical | 14968112, (Europe PMC) | NA | BioGRID |
| AP2A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2A2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2B1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2M1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| ATP13A2 | Affinity Capture-Western, Two-hybrid | physical | 22645275, (Europe PMC) | NA | BioGRID |
| AXIN1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BMP2K | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| C5AR2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CALM1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| CALML3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAPZB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBLC | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CCNG1 | Affinity Capture-Western, Reconstituted Complex | physical | 9013862, (Europe PMC) | NA | BioGRID |
| CDK5 | Affinity Capture-Western | physical | 9013862, (Europe PMC) | NA | BioGRID |
| CEP162 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHMP4A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLASRP | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CLINT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTCL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPM | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPSF7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DAB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| DMWD | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EDRF1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EPS15 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM174A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FAM83B | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| FAM83H | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| FBXW7 | Synthetic Lethality | genetic | 26354767, (Europe PMC) | NA | BioGRID |
| FEM1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GOLGB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GPX7 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIP1R | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPA8 | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification | association, physical, physical association | 24510904, 28514442, 29568061, (Europe PMC) | 0.62 | BioGRID, IntAct |
| HSPBP1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| IARS2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| INF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIDINS220 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIF3A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LGR4 | Affinity Capture-MS | physical | 24639526, (Europe PMC) | NA | BioGRID |
| LIMA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MISP | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MPP5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MYO1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUMB | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| PARP10 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| PHGDH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHKG2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PICALM | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PIK3C2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PLXNA3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPM1B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PSMA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PUS7L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RABGEF1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RBM14 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC24C | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| SP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPTAN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAMBP | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| STAMBPL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STON2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TNK1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| TNK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| USO1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WNK1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| XPR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF106 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTRT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AFAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2A2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2B1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2M1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AR | reverse two hybrid | physical association | 12864730, (Europe PMC) | 0.37 | IntAct |
| ATP13A2 | anti tag coimmunoprecipitation, ubiquitin reconstruction | physical association | 22645275, (Europe PMC) | 0.51 | IntAct |
| AXIN1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BAG5 | anti tag coimmunoprecipitation | association | 24510904, (Europe PMC) | 0.35 | IntAct |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BMP2K | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CALML3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAPZB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP162 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHMP4A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLINT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTCL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPM | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPSF7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DAB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DENND1A | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| EBI-1108795 | anti bait coimmunoprecipitation | association | 14968112, (Europe PMC) | 0.35 | IntAct |
| EDRF1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EPS15 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM83B | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| FAM83H | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| FEM1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GOLGB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIP1R | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSCB | anti bait coimmunoprecipitation | association | 28380382, (Europe PMC) | 0.35 | IntAct |
| HSPA8 | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification | association, physical, physical association | 24510904, 28514442, 29568061, (Europe PMC) | 0.62 | BioGRID, IntAct |
| ICOS | anti bait coimmunoprecipitation | association | 27135603, (Europe PMC) | 0.35 | IntAct |
| INF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIDINS220 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIF3A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LIMA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK1 | protein array | direct interaction | 24947832, (Europe PMC) | 0.44 | IntAct |
| LRRK2 | anti tag coimmunoprecipitation, confocal microscopy, fluorescence microscopy, protein array | association, colocalization, direct interaction, physical association | 24510904, 24947832, 29513927, (Europe PMC) | 0.79 | IntAct |
| MFHAS1 | protein array | direct interaction | 29513927, (Europe PMC) | 0.44 | IntAct |
| MISP | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MYO1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NUMB | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PHGDH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHKG2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PICALM | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PIK3C2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PLXNA3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PUS7L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAB29 | anti tag coimmunoprecipitation | association | 24510904, (Europe PMC) | 0.35 | IntAct |
| RBM14 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC24C | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| SP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPTAN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAMBPL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STON2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TNK1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| TNK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| USO1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| XPR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF106 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTRT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AFAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ALK | Affinity Capture-MS | physical | 14968112, (Europe PMC) | NA | BioGRID |
| AP2A1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2A2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2B1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AP2M1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| AR | reverse two hybrid | physical association | 12864730, (Europe PMC) | 0.37 | IntAct |
| ATP13A2 | Affinity Capture-Western, Two-hybrid | physical | 22645275, (Europe PMC) | NA | BioGRID |
| ATP13A2 | anti tag coimmunoprecipitation, ubiquitin reconstruction | physical association | 22645275, (Europe PMC) | 0.51 | IntAct |
| AXIN1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BAG5 | anti tag coimmunoprecipitation | association | 24510904, (Europe PMC) | 0.35 | IntAct |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BMP2K | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| C5AR2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CALM1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| CALML3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAPZB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBLC | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CCNG1 | Affinity Capture-Western, Reconstituted Complex | physical | 9013862, (Europe PMC) | NA | BioGRID |
| CDK5 | Affinity Capture-Western | physical | 9013862, (Europe PMC) | NA | BioGRID |
| CEP162 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHMP4A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLASRP | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CLINT1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTC | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CLTCL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPM | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CPSF7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DAB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DENND1A | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| DENND1A | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| DMWD | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EBI-1108795 | anti bait coimmunoprecipitation | association | 14968112, (Europe PMC) | 0.35 | IntAct |
| EDRF1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EPS15 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM174A | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FAM83B | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| FAM83B | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| FAM83H | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| FAM83H | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| FBXW7 | Synthetic Lethality | genetic | 26354767, (Europe PMC) | NA | BioGRID |
| FEM1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GOLGB1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GPX7 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| GTSE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIP1R | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSCB | anti bait coimmunoprecipitation | association | 28380382, (Europe PMC) | 0.35 | IntAct |
| HSPA8 | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification | association, physical, physical association | 24510904, 28514442, 29568061, (Europe PMC) | 0.62 | BioGRID, IntAct |
| HSPBP1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| IARS2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ICOS | anti bait coimmunoprecipitation | association | 27135603, (Europe PMC) | 0.35 | IntAct |
| INF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIDINS220 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KIF3A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LGR4 | Affinity Capture-MS | physical | 24639526, (Europe PMC) | NA | BioGRID |
| LIMA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK1 | protein array | direct interaction | 24947832, (Europe PMC) | 0.44 | IntAct |
| LRRK2 | anti tag coimmunoprecipitation, confocal microscopy, fluorescence microscopy, protein array | association, colocalization, direct interaction, physical association | 24510904, 24947832, 29513927, (Europe PMC) | 0.79 | IntAct |
| MFHAS1 | protein array | direct interaction | 29513927, (Europe PMC) | 0.44 | IntAct |
| MISP | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MISP | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MPP5 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MYO1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO6 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUMB | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| NUMB | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PARP10 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| PHGDH | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHKG2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PICALM | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PIK3C2A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PLXNA3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPM1B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PSMA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PUS7L | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAB29 | anti tag coimmunoprecipitation | association | 24510904, (Europe PMC) | 0.35 | IntAct |
| RABGEF1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| RBM14 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC16A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEC24C | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| SEC24C | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| SP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SPTAN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STAMBP | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| STAMBPL1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, 28514442, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STON2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TGOLN2 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TNK1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| TNK1 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| TNK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| USO1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| WNK1 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| XPR1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZNF106 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| Unknown | S1096_LSSGLQGsPAGFPPG, S16_DFLAGPGsLGGASGR, S456_HYAVYNLsPRTYRPS, S770_QYDAGAGsPEAEPTD, S778_PEAEPTDsDSPPSSS, S780_AEPTDSDsPPSSSAD, S783_TDSDSPPsSSADASR, S784_DSDSPPSsSADASRF, S785_SDSPPSSsADASRFL, S789_PSSSADAsRFLHTLD, S811_ETGAENAsSKESESA, S812_TGAENASsKESESAL, S815_ENASSKEsESALMED, S817_ASSKESEsALMEDRD, S826_LMEDRDEsEVSDEGG, S829_DRDESEVsDEGGSPI, S834_EVSDEGGsPISSEGQ, S837_DEGGSPIsSEGQEPR, T776_GSPEAEPtDSDSPPS, T805_QEEKEAEtGAENASS, Y615_VASTSQEyDKMRDFK, | HTP, in vivo | 18452278, 18669648, 18691976, 19413330, 20166139,(Europe PMC) | HPRD, PhosphoELM, |