Top
GAK
Localization (UniProt annotation) Cytoplasm, perinuclear region Golgi apparatus, trans-Golginetwork Cell junction, focaladhesion Note=Localizes to theperinuclear area and to the trans-Golgi network Also seen on theplasma membrane, probably at focal adhesions Function (UniProt annotation) Associates with cyclin G and CDK5 Seems to act as anauxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells Expressionoscillates slightly during the cell cycle, peaking at G1 Catalytic Activity (UniProt annotation) ATP + a protein = ADP + a phosphoprotein Protein Sequence MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNR
AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQ
HMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI
GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAAR
NVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSV
ANYAKGDLDISYITSRIAVMSFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP
HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMC
DMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDV
LIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP
PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDSPPSSSADASRFLHTLDWQEE
KEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEGQEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDG
VDLLGLHSEVGAGPAVPPQACKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP
FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAW
TETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQ
TSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT
IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAPEQVKKHYRRAVLAVHPDKAA
GQPYEQHAKMIFMELNDAWSEFENQGSRPLF
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-432722 Golgi Associated Vesicle Biogenesis. Proteins that have been synthesized, processed and sorted eventually reach the final steps of the secretory pathway. This pathway is responsible not only for proteins that are secreted from the cell but also enzymes and other resident proteins in the lumen of the ER, Golgi, and lysosomes as well as integral proteins transported in the vesicle membranes R-HSA-8856828 Clathrin-mediated endocytosis. Clathrin-mediated endocytosis (CME) is one of a number of process that control the uptake of material from the plasma membrane, and leads to the formation of clathrin-coated vesicles (Pearse et al, 1975; reviewed in Robinson, 2015; McMahon and Boucrot, 2011; Kirchhausen et al, 2014). CME contributes to signal transduction by regulating the cell surface expression and signaling of receptor tyrosine kinases (RTKs) and G-protein coupled receptors (GPCRs). Most RTKs exhibit a robust increase in internalization rate after binding specific ligands; however, some RTKs may also exhibit significant ligand-independent internalization (reviewed in Goh and Sorkin, 2013). CME controls RTK and GPCR signaling by organizing signaling both within the plasma membrane and on endosomes (reviewed in Eichel et al, 2016; Garay et al, 2015; Vieira et al, 1996; Sorkin and von Zastrow, 2014; Di Fiori and von Zastrow, 2014; Barbieri et al, 2016). CME also contributes to the uptake of material such as metabolites, hormones and other proteins from the extracellular space, and regulates membrane composition by recycling membrane components and/or targeting them for degradation. Clathrin-mediated endocytosis involves initiation of clathrin-coated pit (CCP) formation, cargo selection, coat assembly and stabilization, membrane scission and vesicle uncoating. Although for simplicity in this pathway, the steps leading to a mature CCP are represented in a linear and temporally distinct fashion, the formation of a clathrin-coated vesicle is a highly heterogeneous process and clear temporal boundaries between these processes may not exist (see for instance Taylor et al, 2011; Antonescu et al, 2011; reviewed in Kirchhausen et al, 2014). Cargo selection in particular is a critical aspect of the formation of a mature and stable CCP, and many of the proteins involved in the initiation and maturation of a CCP contribute to cargo selection and are themselves stabilized upon incorporation of cargo into the nascent vesicle (reviewed in Kirchhausen et al, 2014; McMahon and Boucrot, 2011).Although the clathrin triskelion was identified early as a major component of the coated vesicles, clathrin does not bind directly to membranes or to the endocytosed cargo. Vesicle formation instead relies on many proteins and adaptors that can bind the plasma membrane and interact with cargo molecules. Cargo selection depends on the recognition of endocytic signals in cytoplasmic tails of the cargo proteins by adaptors that interact with components of the vesicle's inner coat. The classic adaptor for clathrin-coated vesicles is the tetrameric AP-2 complex, which along with clathrin was identified early as a major component of the coat. Some cargo indeed bind directly to AP-2, but subsequent work has revealed a large family of proteins collectively known as CLASPs (clathrin- associated sorting proteins) that mediate the recruitment of diverse cargo into the emerging clathrin-coated vesicles (reviewed in Traub and Bonifacino, 2013). Many of these CLASP proteins themselves interact with AP-2 and clathrin, coordinating cargo recruitment with coat formation (Schmid et al, 2006; Edeling et al, 2006; reviewed in Traub and Bonifacino, 2013; Kirchhausen et al, 2014). Initiation of CCP formation is also influenced by lipid composition, regulated by clathrin-associated phosphatases and kinases (reviewed in Picas et al, 2016). The plasma membrane is enriched in PI(4,5)P2. Many of the proteins involved in initiating clathrin-coated pit formation bind to PI(4,5)P2 and induce membrane curvature through their BAR domains (reviewed in McMahon and Boucrot, 2011; Daumke et al, 2014). Epsin also contributes to early membrane curvature through its Epsin N-terminal homology (ENTH) domain, which promotes membrane curvature by inserting into the lipid bilayer (Ford et al, 2002). Following initiation, some CCPs progress to formation of vesicles, while others undergo disassembly at the cell surface without producing vesicles (Ehrlich et al, 2004; Loerke et al, 2009; Loerke et al, 2011; Aguet et al, 2013; Taylor et al, 2011). The assembly and stabilization of nascent CCPs is regulated by several proteins and lipids (Mettlen et al, 2009; Antonescu et al, 2011).Maturation of the emerging clathrin-coated vesicle is accompanied by further changes in the lipid composition of the membrane and increased membrane curvature, promoted by the recruitment of N-BAR domain containing proteins (reviewed in Daumke et al, 2014; Ferguson and De Camilli, 2012; Picas et al, 2016). Some N-BAR domain containing proteins also contribute to the recruitment of the large GTPase dynamin, which is responsible for scission of the mature vesicle from the plasma membrane (Koh et al, 2007; Lundmark and Carlsson, 2003; Soulet et al, 2005; David et al, 1996; Owen et al, 1998; Shupliakov et al, 1997; Taylor et al, 2011; Ferguson et al, 2009; Aguet et al, 2013; Posor et al, 2013; Chappie et al, 2010; Shnyrova et al, 2013; reviewed in Mettlen et al, 2009; Daumke et al, 2014). After vesicle scission, the clathrin coat is dissociated from the new vesicle by the ATPase HSPA8 (also known as HSC70) and its DNAJ cofactor auxilin, priming the vesicle for fusion with a subsequent endocytic compartment and releasing clathrin for reuse (reviewed in McMahon and Boucrot, 2011; Sousa and Laufer, 2015)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTRT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AFAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ALK Affinity Capture-MS physical 14968112 , (Europe PMC )NA BioGRID AP2A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2M1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID ATP13A2 Affinity Capture-Western, Two-hybrid physical 22645275 , (Europe PMC )NA BioGRID AXIN1 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct BMP2K Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct C5AR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CALM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CALML3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CBLC Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCNG1 Affinity Capture-Western, Reconstituted Complex physical 9013862 , (Europe PMC )NA BioGRID CDK5 Affinity Capture-Western physical 9013862 , (Europe PMC )NA BioGRID CEP162 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP4A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLASRP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLINT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTCL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPSF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DAB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DENND1A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID DMWD Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EDRF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EPS15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FAM174A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FAM83B Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FAM83H Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FBXW7 Synthetic Lethality genetic 26354767 , (Europe PMC )NA BioGRID FEM1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GOLGB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GPX7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GTSE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HIP1R Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct HSPA8 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical, physical association 24510904 , 28514442 , 29568061 , (Europe PMC )0.62 BioGRID, IntAct HSPBP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IARS2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIDINS220 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF3A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LGR4 Affinity Capture-MS physical 24639526 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MISP Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MPP5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUMB Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PARP10 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PHGDH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PHKG2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PICALM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PIK3C2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLXNA3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPM1B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PUS7L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RABGEF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RBM14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC16A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC24C Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTAN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STAMBP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID STAMBPL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TNK1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TNK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID USO1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct WNK1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID XPR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZNF106 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTRT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AFAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2M1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AR reverse two hybrid physical association 12864730 , (Europe PMC )0.37 IntAct ATP13A2 anti tag coimmunoprecipitation, ubiquitin reconstruction physical association 22645275 , (Europe PMC )0.51 IntAct AXIN1 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct BAG5 anti tag coimmunoprecipitation association 24510904 , (Europe PMC )0.35 IntAct BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BMP2K Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CALML3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CEP162 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP4A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLINT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTCL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPSF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DAB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DENND1A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct EDRF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EPS15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FAM83B anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FAM83H anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FEM1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GOLGB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GTSE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HIP1R Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct HSPA8 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical, physical association 24510904 , 28514442 , 29568061 , (Europe PMC )0.62 BioGRID, IntAct ICOS anti bait coimmunoprecipitation association 27135603 , (Europe PMC )0.35 IntAct INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIDINS220 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF3A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LRRK1 protein array direct interaction 24947832 , (Europe PMC )0.44 IntAct LRRK2 anti tag coimmunoprecipitation, confocal microscopy, fluorescence microscopy, protein array association, colocalization, direct interaction, physical association 24510904 , 24947832 , 29513927 , (Europe PMC )0.79 IntAct MFHAS1 protein array direct interaction 29513927 , (Europe PMC )0.44 IntAct MISP anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NUMB anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct OCRL anti tag coimmunoprecipitation association 25107275 , (Europe PMC )0.35 IntAct, MINT PHGDH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PHKG2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PICALM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PIK3C2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLXNA3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PSMA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PUS7L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAB29 anti tag coimmunoprecipitation association 24510904 , (Europe PMC )0.35 IntAct RBM14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC16A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC24C anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct SP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTAN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STAMBPL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TGOLN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TNK1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct TNK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct USO1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct XPR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZNF106 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTRT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AFAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ALK Affinity Capture-MS physical 14968112 , (Europe PMC )NA BioGRID AP2A1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2A2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AP2M1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APP Reconstituted Complex physical 21832049 , (Europe PMC )NA BioGRID AR reverse two hybrid physical association 12864730 , (Europe PMC )0.37 IntAct ATP13A2 Affinity Capture-Western, Two-hybrid physical 22645275 , (Europe PMC )NA BioGRID ATP13A2 anti tag coimmunoprecipitation, ubiquitin reconstruction physical association 22645275 , (Europe PMC )0.51 IntAct AXIN1 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct BAG5 anti tag coimmunoprecipitation association 24510904 , (Europe PMC )0.35 IntAct BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BMP2K Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct C5AR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CALM1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID CALML3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CBLC Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCNG1 Affinity Capture-Western, Reconstituted Complex physical 9013862 , (Europe PMC )NA BioGRID CDK5 Affinity Capture-Western physical 9013862 , (Europe PMC )NA BioGRID CEP162 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHMP4A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLASRP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLINT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTC Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CLTCL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CPSF7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DAB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DENND1A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID DENND1A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct DMWD Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct EDRF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EPS15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FAM174A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FAM83B Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FAM83B anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FAM83H Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FAM83H anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FBXW7 Synthetic Lethality genetic 26354767 , (Europe PMC )NA BioGRID FEM1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GOLGB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GPX7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GTSE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HIP1R Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct HSPA8 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, physical, physical association 24510904 , 28514442 , 29568061 , (Europe PMC )0.62 BioGRID, IntAct HSPBP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IARS2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ICOS anti bait coimmunoprecipitation association 27135603 , (Europe PMC )0.35 IntAct INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIDINS220 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF3A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LGR4 Affinity Capture-MS physical 24639526 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LRRK1 protein array direct interaction 24947832 , (Europe PMC )0.44 IntAct LRRK2 anti tag coimmunoprecipitation, confocal microscopy, fluorescence microscopy, protein array association, colocalization, direct interaction, physical association 24510904 , 24947832 , 29513927 , (Europe PMC )0.79 IntAct MFHAS1 protein array direct interaction 29513927 , (Europe PMC )0.44 IntAct MISP Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MISP anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MPP5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUMB Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID NUMB anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct OCRL anti tag coimmunoprecipitation association 25107275 , (Europe PMC )0.35 IntAct, MINT PARP10 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PHGDH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PHKG2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PICALM Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PIK3C2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLXNA3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPM1B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PUS7L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAB29 anti tag coimmunoprecipitation association 24510904 , (Europe PMC )0.35 IntAct RABGEF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RBM14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC16A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SEC24C Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SEC24C anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct SP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SPTAN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STAMBP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID STAMBPL1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TGOLN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TNK1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TNK1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct TNK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID USO1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct WNK1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID XPR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZNF106 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown S1096_LSSGLQGsPAGFPPG , S16_DFLAGPGsLGGASGR , S456_HYAVYNLsPRTYRPS , S770_QYDAGAGsPEAEPTD , S778_PEAEPTDsDSPPSSS , S780_AEPTDSDsPPSSSAD , S783_TDSDSPPsSSADASR , S784_DSDSPPSsSADASRF , S785_SDSPPSSsADASRFL , S789_PSSSADAsRFLHTLD , S811_ETGAENAsSKESESA , S812_TGAENASsKESESAL , S815_ENASSKEsESALMED , S817_ASSKESEsALMEDRD , S826_LMEDRDEsEVSDEGG , S829_DRDESEVsDEGGSPI , S834_EVSDEGGsPISSEGQ , S837_DEGGSPIsSEGQEPR , T776_GSPEAEPtDSDSPPS , T805_QEEKEAEtGAENASS , Y615_VASTSQEyDKMRDFK , HTP, in vivo 18452278 , 18669648 , 18691976 , 19413330 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,