Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ENOPH1
Gene Name  | ENOPH1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | ENOPH1 , MASA , MSTP145 | |
| Protein Name | ENOPH1 |
|
| Alternative Name(s) |
Enolase-phosphatase E1;3.1.3.77;2,3-diketo-5-methylthio-1-phosphopentane phosphatase;MASA homolog; | |
| EntrezGene ID | 58478 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9UHY7 (protein sequence) | |
| Enzyme Class | EC 3.1.3.77 (BRENDA ) | |
| Molecular Weight | 28933 Dalton | |
| Protein Length | 261 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000145293 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD | Historic class: HAD-like hydrolase | CATH ID: 3.40.50.1000 | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus | |||
| Function (UniProt annotation) | |||
| Bifunctional enzyme that catalyzes the enolization of2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into theintermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate(HK-MTPenyl-1-P), which is then dephosphorylated to form theacireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) | |||
| Catalytic Activity (UniProt annotation) | |||
| 5-(methylthio)-2,3-dioxopentyl phosphate +H(2)O = 1,2-dihydroxy-5-(methylthio)pent-1-en-3-one + phosphate | |||
| Protein Sequence | |||
| MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASG NGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQ KLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTD DEKTYYSLITSFSELYLPSST |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000287 | F:magnesium ion binding |
| GO:0005634 | C:nucleus |
| GO:0005829 | C:cytosol |
| GO:0019284 | P:L-methionine salvage from S-adenosylmethionine |
| GO:0019509 | P:L-methionine salvage from methylthioadenosine |
| GO:0043715 | F:2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity |
| GO:0043716 | F:2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity |
| GO:0043874 | F:acireductone synthase activity |
