Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
DUSP18
Gene Name  | DUSP18 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | DUSP18, LMWDSP20 | |
| Protein Name | DUSP18 |
|
| Alternative Name(s) |
Dual specificity protein phosphatase 18;3.1.3.16;3.1.3.48;Low molecular weight dual specificity phosphatase 20;LMW-DSP20; | |
| EntrezGene ID | 150290 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q8NEJ0 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 21066 Dalton | |
| Protein Length | 188 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000167065 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Class I Cys-based PTPs --> VH1-like or DSPs --> Atypical DSPs | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCAAGVSR | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Mitochondrion innermembrane Note=Translocates to cytoplasm inresponse to apoptotic stimuli such as staurosporine treatment | |||
| Function (UniProt annotation) | |||
| Can dephosphorylate single and diphosphorylatedsynthetic MAPK peptides, with preference for the phosphotyrosineand diphosphorylated forms over phosphothreonine In vitro,dephosphorylates p-nitrophenyl phosphate (pNPP) | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLC DFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFG KNTVHMVSSPVGMIPDIYEKEVRLMIPL |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005743 | C:mitochondrial inner membrane |
| GO:0008138 | F:protein tyrosine/serine/threonine phosphatase activity |
| GO:0016311 | P:dephosphorylation |
| GO:0016791 | F:phosphatase activity |
| GO:0017017 | F:MAP kinase tyrosine/serine/threonine phosphatase activity |
| GO:0035335 | P:peptidyl-tyrosine dephosphorylation |
| GO:0035970 | P:peptidyl-threonine dephosphorylation |
