Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CPPED1
Gene Name  | CPPED1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | CPPED1, CSTP1 | |
| Protein Name | CPPED1 |
|
| Alternative Name(s) |
Serine/threonine-protein phosphatase CPPED1;3.1.3.16;Calcineurin-like phosphoesterase domain-containing protein 1;Complete S-transactivated protein 1; | |
| EntrezGene ID | 55313 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9BRF8 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 35548 Dalton | |
| Protein Length | 314 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000103381 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPPL | Historic class: PSTPs --> PPP | CATH ID: NA | SCOP Fold: NA | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Protein phosphatase that dephosphorylates AKT familykinase specifically at 'Ser-473', blocking cell cycle progressionand promoting cell apoptosis May play an inhibitory role inglucose uptake by adipocytes | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MSAAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINKLNP KPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGNHDIGNTPTAETVEEFCRTWGDDYFSFWVGGVLF LVLNSQFYENPSKCPSLKQAQDQWLDEQLSIARQRHCQHAIVFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGV KVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVHRYYSLDELSEKGIEDDLMDLIKKK |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004721 | F:phosphoprotein phosphatase activity |
| GO:0005576 | C:extracellular region |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0035578 | C:azurophil granule lumen |
| GO:0043312 | P:neutrophil degranulation |
| GO:0046872 | F:metal ion binding |