Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ACP6
Gene Name  | ACP6 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | ACP6, ACPL1, LPAP, UNQ205/PRO231 | |
| Protein Name | ACP6 |
|
| Alternative Name(s) |
Lysophosphatidic acid phosphatase type 6;3.1.3.2;Acid phosphatase 6, lysophosphatidic;Acid phosphatase-like protein 1;PACPL1; | |
| EntrezGene ID | 51205 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9NPH0 (protein sequence) | |
| Enzyme Class | EC 3.1.3.2 (BRENDA ) | |
| Molecular Weight | 48886 Dalton | |
| Protein Length | 428 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000162836 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) | Historic class: Histidine acid phosphatase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Mitochondrion | |||
| Function (UniProt annotation) | |||
| Hydrolyzes lysophosphatidic acid (LPA) containing amedium length fatty acid chain to the correspondingmonoacylglycerol Has highest activity with lysophosphatidic acidcontaining myristate (C14:0), monounsaturated oleate (C18:1) orpalmitate (C16:0), and lower activity with C18:0 and C6:0lysophosphatidic acid | |||
| Catalytic Activity (UniProt annotation) | |||
| A phosphate monoester + H(2)O = an alcohol +phosphate | |||
| Protein Sequence | |||
| MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQL LEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVF IRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQPGISEDLKKVKDRMG IDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAMDSAT APDKIRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQVPRGCPDGLCPLDMFLN AMSVYTLSPEKYHALCSQTQVMEVGNEE |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0002244 | P:hematopoietic progenitor cell differentiation |
| GO:0003993 | F:acid phosphatase activity |
| GO:0005737 | C:cytoplasm |
| GO:0005739 | C:mitochondrion |
| GO:0005759 | C:mitochondrial matrix |
| GO:0006644 | P:phospholipid metabolic process |
| GO:0006654 | P:phosphatidic acid biosynthetic process |
| GO:0052642 | F:lysophosphatidic acid phosphatase activity |
| GO:2001311 | P:lysobisphosphatidic acid metabolic process |
