Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ACP5
Gene Name  | ACP5 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | ACP5 | |
| Protein Name | ACP5 |
|
| Alternative Name(s) |
Tartrate-resistant acid phosphatase type 5;TR-AP;3.1.3.2;Tartrate-resistant acid ATPase;TrATPase;Type 5 acid phosphatase; | |
| EntrezGene ID | 54 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P13686 (protein sequence) | |
| Enzyme Class | EC 3.1.3.2 (BRENDA ) | |
| Molecular Weight | 36599 Dalton | |
| Protein Length | 325 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000102575 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPPL | Historic class: Purple acid phosphatase | CATH ID: 3.60.21.10 | SCOP Fold: PPPL | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Lysosome | |||
| Function (UniProt annotation) | |||
| Involved in osteopontin/bone sialoproteindephosphorylation Its expression seems to increase in certainpathological states such as Gaucher and Hodgkin diseases, thehairy cell, the B-cell, and the T-cell leukemias | |||
| Catalytic Activity (UniProt annotation) | |||
| A phosphate monoester + H(2)O = an alcohol +phosphate | |||
| Protein Sequence | |||
| MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLGDNFYFTGVQD INDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTL CGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLP RRARP |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003993 | F:acid phosphatase activity |
| GO:0005764 | C:lysosome |
| GO:0005829 | C:cytosol |
| GO:0006771 | P:riboflavin metabolic process |
| GO:0008198 | F:ferrous iron binding |
| GO:0008199 | F:ferric iron binding |
| GO:0016021 | C:integral component of membrane |
| GO:0032496 | P:response to lipopolysaccharide |
| GO:0032691 | P:negative regulation of interleukin-1 beta production |
| GO:0032695 | P:negative regulation of interleukin-12 production |
| GO:0032720 | P:negative regulation of tumor necrosis factor production |
| GO:0032929 | P:negative regulation of superoxide anion generation |
| GO:0034097 | P:response to cytokine |
| GO:0045019 | P:negative regulation of nitric oxide biosynthetic process |
| GO:0045453 | P:bone resorption |
| GO:0050728 | P:negative regulation of inflammatory response |
| GO:0050830 | P:defense response to Gram-positive bacterium |
| GO:0060349 | P:bone morphogenesis |
