Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ACP4
Gene Name  | ACP4 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | ACP4 , ACPT | |
| Protein Name | ACP4 |
|
| Alternative Name(s) |
Testicular acid phosphatase;3.1.3.2;Acid phosphatase 4; | |
| EntrezGene ID | 93650 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q9BZG2 (protein sequence) | |
| Enzyme Class | EC 3.1.3.2 (BRENDA ) | |
| Molecular Weight | 46090 Dalton | |
| Protein Length | 426 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000142513 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) | Historic class: Histidine acid phosphatase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: RHGD | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Membrane | |||
| Function (UniProt annotation) | |||
| May dephosphorylate receptor tyrosine-protein kinaseERBB4 and inhibits its ligand-induced proteolytic cleavage(PubMed:15219672) May play a role in odontogenesis(PubMed:27843125) | |||
| Catalytic Activity (UniProt annotation) | |||
| A phosphate monoester + H(2)O = an alcohol +phosphate | |||
| Protein Sequence | |||
| MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVASTLWPRGLGQLTTEGVRQQLE LGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPEARWRPIPVHTVPVAEDKLLRFPMRSCP RYHELLREATEAAEYQEALEGWTGFLSRLENFTGLSLVGEPLRRAWKVLDTLMCQQAHGLPLPAWASPDVLRTLAQISAL DIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPLKMVMYSAHDSTLLALQGALGLYDGHTPPYAACLGFEFRKH LGNPAKDGGNVTVSLFYRNDSAHLPLPLSLPGCPAPCPLGRFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVA VLVALSLGLGLLAWRPGCLRALGGPV |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003993 | F:acid phosphatase activity |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0010955 | P:negative regulation of protein processing |
| GO:0010977 | P:negative regulation of neuron projection development |
| GO:0016021 | C:integral component of membrane |
| GO:0030971 | F:receptor tyrosine kinase binding |
| GO:0042476 | P:odontogenesis |
| GO:0045211 | C:postsynaptic membrane |
| GO:0048168 | P:regulation of neuronal synaptic plasticity |
| GO:0120154 | P:negative regulation of ERBB4 signaling pathway |
| GO:1990264 | P:peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity |
