Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
ACP2
Gene Name  | ACP2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | ACP2 | |
| Protein Name | ACP2 |
|
| Alternative Name(s) |
Lysosomal acid phosphatase;LAP;3.1.3.2; | |
| EntrezGene ID | 53 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P11117 (protein sequence) | |
| Enzyme Class | EC 3.1.3.2 (BRENDA ) | |
| Molecular Weight | 48344 Dalton | |
| Protein Length | 423 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000134575 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: histidine phosphatase (HP) | Historic class: Histidine acid phosphatase | CATH ID: 3.40.50.1240 | SCOP Fold: HP | |
| Phosphatase activity | active | Catalytic signature motif: RHGD | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Lysosome membrane Lysosomelumen Note=The soluble form arises by proteolytic processing ofthe membrane-bound form | |||
| Function (UniProt annotation) | |||
| NA | |||
| Catalytic Activity (UniProt annotation) | |||
| A phosphate monoester + H(2)O = an alcohol +phosphate | |||
| Protein Sequence | |||
| MAGKRSGWSRAALLQLLLGVNLVVMPPTRARSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELG QALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCP RYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSF RFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQEDS GNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRLTEPVVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLL TVLFRMQAQPPGYRHVADGEDHA |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| TRG_ENDOCYTIC_2 | 413-YRHV-416 | Y-based sorting signal | Y..[LMVIF] |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001501 | P:skeletal system development |
| GO:0003993 | F:acid phosphatase activity |
| GO:0005764 | C:lysosome |
| GO:0005765 | C:lysosomal membrane |
| GO:0007040 | P:lysosome organization |
| GO:0016020 | C:membrane |
| GO:0016021 | C:integral component of membrane |
| GO:0043202 | C:lysosomal lumen |
| GO:0070062 | C:extracellular exosome |