Top
JUN
Localization (UniProt annotation) Nucleus Function (UniProt annotation) Transcription factor that recognizes and binds to theenhancer heptamer motif 5'-TGA[CG]TCA-3' Promotes activity ofNR5A1 when phosphorylated by HIPK3 leading to increasedsteroidogenic gene expression upon cAMP signaling pathwaystimulation Involved in activated KRAS-mediated transcriptionalactivation of USP28 in colorectal cancer (CRC) cells(PubMed:24623306) Binds to the USP28 promoter in colorectalcancer (CRC) cells (PubMed:24623306) Catalytic Activity (UniProt annotation) N/A Protein Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLI
IQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFS
ASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGC
QLMLTQQLQTF
JUN is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa01522 Endocrine resistance Endocrine therapy is a key treatment strategy to control or eradicate hormone-responsive breast cancer. The most commonly used endocrine therapy agents are selective estrogen receptor modulators (SERMs, e.g. tamoxifen), estrogen synthesis inhibitors (e.g. aromatase inhibitors (AIs) such as anastrozole, letrozole, and exemestane), and selective estrogen receptor down-regulators (SERDs, e.g. fulvestrant). However, resistance to these agents has become a major clinical obstacle. Mechanisms of endocrine resistance include loss of ER-alpha expression, altered expression of coactivators or coregulators that play a critical role in ER-mediated gene transcription, ligand-independent growth factor signaling cascades that activate kinases and ER-phosphorylation, altered availability of active tamoxifen metabolites regulated by drug-metabolizing enzymes, such as CYP2D6, and deregulation of the cell cycle and apoptotic machinery. hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04012 ErbB signaling pathway The ErbB family of receptor tyrosine kinases (RTKs) couples binding of extracellular growth factor ligands to intracellular signaling pathways regulating diverse biologic responses, including proliferation, differentiation, cell motility, and survival. Ligand binding to the four closely related members of this RTK family -epidermal growth factor receptor (EGFR, also known as ErbB-1 or HER1), ErbB-2 (HER2), ErbB-3 (HER3), and ErbB-4 (HER4)-induces the formation of receptor homo- and heterodimers and the activation of the intrinsic kinase domain, resulting in phosphorylation on specific tyrosine residues (pY) within the cytoplasmic tail. Signaling effectors containing binding pockets for pY-containing peptides are recruited to activated receptors and induce the various signaling pathways. The Shc- and/or Grb2-activated mitogen-activated protein kinase (MAPK) pathway is a common target downstream of all ErbB receptors. Similarly, the phosphatidylinositol-3-kinase (PI-3K) pathway is directly or indirectly activated by most ErbBs. Several cytoplasmic docking proteins appear to be recruited by specific ErbB receptors and less exploited by others. These include the adaptors Crk, Nck, the phospholipase C gamma (PLCgamma), the intracellular tyrosine kinase Src, or the Cbl E3 ubiquitin protein ligase. hsa04024 cAMP signaling pathway cAMP is one of the most common and universal second messengers, and its formation is promoted by adenylyl cyclase (AC) activation after ligation of G protein-coupled receptors (GPCRs) by ligands including hormones, neurotransmitters, and other signaling molecules. cAMP regulates pivotal physiologic processes including metabolism, secretion, calcium homeostasis, muscle contraction, cell fate, and gene transcription. cAMP acts directly on three main targets: protein kinase A (PKA), the exchange protein activated by cAMP (Epac), and cyclic nucleotide-gated ion channels (CNGCs). PKA modulates, via phosphorylation, a number of cellular substrates, including transcription factors, ion channels, transporters, exchangers, intracellular Ca2+ -handling proteins, and the contractile machinery. Epac proteins function as guanine nucleotide exchange factors (GEFs) for both Rap1 and Rap2. Various effector proteins, including adaptor proteins implicated in modulation of the actin cytoskeleton, regulators of G proteins of the Rho family, and phospholipases, relay signaling downstream from Rap. hsa04137 Mitophagy - animal Mitochondria act as the energy powerhouse of the cell, and are essential for eukaryotic cells to grow and function normally. However, deleterious byproducts of oxidative phosphorylation process called reactive oxidative species (ROS) lead to mitochondrial dysfunction. If the damage is too excessive to be repaired, such mitochondria are selectively recognized and targeted for degradation by a specific mode of autophagy, termed mitophagy. The loss of the mitochondrial membrane potential can induce mitophagy, involving the kinase PINK1 and the E3 ligase Parkin. PINK1 serves as the sensor for the mitochondrial depolarization and recruits Parkin, followed by ubiquitin-dependent recruitment of mitophagy receptors. There are also several PINK1/Parkin-independent mitophagy pathways, in which a group of LIR-containing receptors are required in response to different stimuli. Mitophagy contributes to the maintenance of a healthy mitochondrial network and the prevention of programmed cell death. hsa04210 Apoptosis Apoptosis is a genetically programmed process for the elimination of damaged or redundant cells by activation of caspases (aspartate-specific cysteine proteases). The onset of apoptosis is controlled by numerous interrelating processes. The 'extrinsic' pathway involves stimulation of members of the tumor necrosis factor (TNF) receptor subfamily, such as TNFRI, CD95/Fas or TRAILR (death receptors), located at the cell surface, by their specific ligands, such as TNF-alpha, FasL or TRAIL, respectively. The 'intrinsic' pathway is activated mainly by non-receptor stimuli, such as DNA damage, ER stress, metabolic stress, UV radiation or growth-factor deprivation. The central event in the 'intrinsic' pathway is the mitochondrial outer membrane permeabilization (MOMP), which leads to the release of cytochrome c. These two pathways converge at the level of effector caspases, such as caspase-3 and caspase-7. The third major pathway is initiated by the constituents of cytotoxic granules (e.g. Perforin and Granzyme B) that are released by CTLs (cytotoxic T-cells) and NK (natural killer) cells. Granzyme B, similarly to the caspases, cleaves its substrates after aspartic acid residues, suggesting that this protease has the ability to activate members of the caspase family directly. It is the balance between the pro-apoptotic and anti-apoptotic signals that eventually determines whether cells will undergo apoptosis, survive or proliferate. TNF family of ligands activates anti-apoptotic or cell-survival signals as well as apoptotic signals. NGF and Interleukin-3 promotes the survival, proliferation and differentiation of neurons or hematopoietic cells, respectively. Withdrawal of these growth factors leads to cell death, as described above. hsa04310 Wnt signaling pathway Wnt proteins are secreted morphogens that are required for basic developmental processes, such as cell-fate specification, progenitor-cell proliferation and the control of asymmetric cell division, in many different species and organs. There are at least three different Wnt pathways: the canonical pathway, the planar cell polarity (PCP) pathway and the Wnt/Ca2+ pathway. In the canonical Wnt pathway, the major effect of Wnt ligand binding to its receptor is the stabilization of cytoplasmic beta-catenin through inhibition of the bea-catenin degradation complex. Beta-catenin is then free to enter the nucleus and activate Wnt-regulated genes through its interaction with TCF (T-cell factor) family transcription factors and concomitant recruitment of coactivators. Planar cell polarity (PCP) signaling leads to the activation of the small GTPases RHOA (RAS homologue gene-family member A) and RAC1, which activate the stress kinase JNK (Jun N-terminal kinase) and ROCK (RHO-associated coiled-coil-containing protein kinase 1) and leads to remodelling of the cytoskeleton and changes in cell adhesion and motility. WNT-Ca2+ signalling is mediated through G proteins and phospholipases and leads to transient increases in cytoplasmic free calcium that subsequently activate the kinase PKC (protein kinase C) and CAMKII (calcium calmodulin mediated kinase II) and the phosphatase calcineurin. hsa04380 Osteoclast differentiation The osteoclasts, multinucleared cells originating from the hematopoietic monocyte-macrophage lineage, are responsible for bone resorption. Osteoclastogenesis is mainly regulated by signaling pathways activated by RANK and immune receptors, whose ligands are expressed on the surface of osteoblasts. Signaling from RANK changes gene expression patterns through transcription factors like NFATc1 and characterizes the active osteoclast. hsa04510 Focal adhesion Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. hsa04530 Tight junction Tight junctions (TJs) are essential for establishing a selectively permeable barrier to diffusion through the paracellular space between neighboring cells. TJs are composed of at least three types of transmembrane protein -occludin, claudin and junctional adhesion molecules (JAMs)- and a cytoplasmic 'plaque' consisting of many different proteins that form large complexes. These are proposed to be involved in junction assembly, barrier regulation, cell polarity, gene transcription, and other pathways. hsa04620 Toll-like receptor signaling pathway Specific families of pattern recognition receptors are responsible for detecting microbial pathogens and generating innate immune responses. Toll-like receptors (TLRs) are membrane-bound receptors identified as homologs of Toll in Drosophila. Mammalian TLRs are expressed on innate immune cells, such as macrophages and dendritic cells, and respond to the membrane components of Gram-positive or Gram-negative bacteria. Pathogen recognition by TLRs provokes rapid activation of innate immunity by inducing production of proinflammatory cytokines and upregulation of costimulatory molecules. TLR signaling pathways are separated into two groups: a MyD88-dependent pathway that leads to the production of proinflammatory cytokines with quick activation of NF-{kappa}B and MAPK, and a MyD88-independent pathway associated with the induction of IFN-beta and IFN-inducible genes, and maturation of dendritic cells with slow activation of NF-{kappa}B and MAPK. hsa04621 NOD-like receptor signaling pathway Specific families of pattern recognition receptors are responsible for detecting various pathogens and generating innate immune responses. The intracellular NOD-like receptor (NLR) family contains more than 20 members in mammals and plays a pivotal role in the recognition of intracellular ligands. NOD1 and NOD2, two prototypic NLRs, sense the cytosolic presence of the bacterial peptidoglycan fragments that escaped from endosomal compartments, driving the activation of NF-{kappa}B and MAPK, cytokine production and apoptosis. On the other hand, a different set of NLRs induces caspase-1 activation through the assembly of multiprotein complexes called inflammasomes. The activated of caspase-1 regulates maturation of the pro-inflammatory cytokines IL-1B, IL-18 and drives pyroptosis. hsa04625 C-type lectin receptor signaling pathway C-type lectin receptors (CLRs) are a large superfamily of proteins characterized by the presence of one or more C-type lectin-like domains (CTLDs). CLRs function as pattern-recognition receptors (PRRs) for pathogen-derived ligands in dendric cells, macrophages, neutrophils, etc., such as Dectin-1 and Dectin-2 for recognition of fungi-derived B-glucan and high mannose-type carbohydrates. Upon ligand binding, CLRs stimulate intracellular signaling cascades that induce the production of inflammatory cytokines and chemokines, consequently triggering innate and adaptive immunity to pathogens. hsa04657 IL-17 signaling pathway The interleukin 17 (IL-17) family, a subset of cytokines consisting of IL-17A-F, plays crucial roles in both acute and chronic inflammatory responses. IL-17A, the hallmark cytokine of the newly defined T helper 17 (TH17) cell subset, has important roles in protecting the host against extracellular pathogens, but also promotes inflammatory pathology in autoimmune disease, whereas IL-17F is mainly involved in mucosal host defense mechanisms. IL-17E (IL-25) is an amplifier of Th2 immune responses. IL-17C has biological functions similar to those of IL-17A. The functions of IL-17B and IL-17D remain largely elusive. The IL-17 family signals via their correspondent receptors and activates downstream pathways that include NF-kappaB, MAPKs and C/EBPs to induce the expression of antimicrobial peptides, cytokines and chemokines. The receptor proximal adaptor Act1 (an NF-kappaB activator 1) is considered as the master mediator in IL-17A signaling. It is likely that Act1 is a common signal adaptor also shared by other members mediated signalings in this family. hsa04658 Th1 and Th2 cell differentiation Immunity to different classes of microorganisms is orchestrated by separate lineages of effector T helper (TH)-cells, which differentiate from naive CD4+ precursor cells in response to cues provided by antigen presenting cells (APC) and include T helper type 1 (Th1) and Th2. Th1 cells are characterized by the transcription factor T-bet and signal transducer and activator of transcription (STAT) 4, and the production of IFN-gamma. These cells stimulate strong cell-mediated immune responses, particularly against intracellular pathogens. On the other hand, transcription factors like GATA-3 and STAT6 drive the generation of Th2 cells that produce IL-4, IL-5 and IL-13 and are necessary for inducing the humoral response to combat parasitic helminths (type 2 immunity) and isotype switching to IgG1 and IgE. The balance between Th1/Th2 subsets determines the susceptibility to disease states, where the improper development of Th2 cells can lead to allergy, while an overactive Th1 response can lead to autoimmunity. hsa04659 Th17 cell differentiation Interleukin (IL)-17-producing helper T (Th17) cells serve as a subset of CD4+ T cells involved in epithelial cell- and neutrophil mediated immune responses against extracellular microbes and in the pathogenesis of autoimmune diseases. In vivo, Th17 differentiation requires antigen presentation and co-stimulation, and activation of antigen presenting-cells (APCs) to produce TGF-beta, IL-6, IL-1, IL-23 and IL-21. This initial activation results in the activation and up-regulation of STAT3, ROR(gamma)t and other transcriptional factors in CD4+ T cells, which bind to the promoter regions of the IL-17, IL-21 and IL-22 genes and induce IL-17, IL-21 and IL-22. In contrast, the differentiation of Th17 cells and their IL-17 expression are negatively regulated by IL-2, Th2 cytokine IL-4, IL-27 and Th1 cytokine IFN-gamma through STAT5, STAT6 and STAT1 activation, respectively. Retinoid acid and the combination of IL-2 and TGF-beta upregulate Foxp3, which also downregulates cytokines like IL-17 and IL-21. The inhibition of Th17 differentiation may serve as a protective strategy to 'fine-tune' the expression IL-17 so it does not cause excessive inflammation. Thus, balanced differentiation of Th cells is crucial for immunity and host protection. hsa04660 T cell receptor signaling pathway Activation of T lymphocytes is a key event for an efficient response of the immune system. It requires the involvement of the T-cell receptor (TCR) as well as costimulatory molecules such as CD28. Engagement of these receptors through the interaction with a foreign antigen associated with major histocompatibility complex molecules and CD28 counter-receptors B7.1/B7.2, respectively, results in a series of signaling cascades. These cascades comprise an array of protein-tyrosine kinases, phosphatases, GTP-binding proteins and adaptor proteins that regulate generic and specialised functions, leading to T-cell proliferation, cytokine production and differentiation into effector cells. hsa04662 B cell receptor signaling pathway B cells are an important component of adaptive immunity. They produce and secrete millions of different antibody molecules, each of which recognizes a different (foreign) antigen. The B cell receptor (BCR) is an integral membrane protein complex that is composed of two immunoglobulin (Ig) heavy chains, two Ig light chains and two heterodimers of Ig-alpha and Ig-beta. After BCR ligation by antigen, three main protein tyrosine kinases (PTKs) -the SRC-family kinase LYN, SYK and the TEC-family kinase BTK- are activated. Phosphatidylinositol 3-kinase (PI3K) and phospholipase C-gamma 2 (PLC-gamma 2) are important downstream effectors of BCR signalling. This signalling ultimately results in the expression of immediate early genes that further activate the expression of other genes involved in B cell proliferation, differentiation and Ig production as well as other processes. hsa04668 TNF signaling pathway Tumor necrosis factor (TNF), as a critical cytokine, can induce a wide range of intracellular signal pathways including apoptosis and cell survival as well as inflammation and immunity. Activated TNF is assembled to a homotrimer and binds to its receptors (TNFR1, TNFR2) resulting in the trimerization of TNFR1 or TNFR2. TNFR1 is expressed by nearly all cells and is the major receptor for TNF (also called TNF-alpha). In contrast, TNFR2 is expressed in limited cells such as CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells. It is the receptor for both TNF and LTA (also called TNF-beta). Upon binding of the ligand, TNFR mediates the association of some adaptor proteins such as TRADD or TRAF2, which in turn initiate recruitment of signal transducers. TNFR1 signaling induces activation of many genes, primarily controlled by two distinct pathways, NF-kappa B pathway and the MAPK cascade, or apoptosis and necroptosis. TNFR2 signaling activates NF-kappa B pathway including PI3K-dependent NF-kappa B pathway and JNK pathway leading to survival. hsa04722 Neurotrophin signaling pathway Neurotrophins are a family of trophic factors involved in differentiation and survival of neural cells. The neurotrophin family consists of nerve growth factor (NGF), brain derived neurotrophic factor (BDNF), neurotrophin 3 (NT-3), and neurotrophin 4 (NT-4). Neurotrophins exert their functions through engagement of Trk tyrosine kinase receptors or p75 neurotrophin receptor (p75NTR). Neurotrophin/Trk signaling is regulated by connecting a variety of intracellular signaling cascades, which include MAPK pathway, PI-3 kinase pathway, and PLC pathway, transmitting positive signals like enhanced survival and growth. On the other hand, p75NTR transmits both positive and nagative signals. These signals play an important role for neural development and additional higher-order activities such as learning and memory. hsa04912 GnRH signaling pathway Gonadotropin-releasing hormone (GnRH) secretion from the hypothalamus acts upon its receptor in the anterior pituitary to regulate the production and release of the gonadotropins, LH and FSH. The GnRHR is coupled to Gq/11 proteins to activate phospholipase C which transmits its signal to diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG activates the intracellular protein kinase C (PKC) pathway and IP3 stimulates release of intracellular calcium. In addition to the classical Gq/11, coupling of Gs is occasionally observed in a cell-specific fashion. Signaling downstream of protein kinase C (PKC) leads to transactivation of the epidermal growth factor (EGF) receptor and activation of mitogen-activated protein kinases (MAPKs), including extracellular-signal-regulated kinase (ERK), Jun N-terminal kinase (JNK) and p38 MAPK. Active MAPKs translocate to the nucleus, resulting in activation of transcription factors and rapid induction of early genes. hsa04915 Estrogen signaling pathway Estrogens are steroid hormones that regulate a plethora of physiological processes in mammals, including reproduction, cardiovascular protection, bone integrity, cellular homeostasis, and behavior. Estrogen mediates its cellular actions through two signaling pathways classified as nuclear-initiated steroid signalingand membrane-initiated steroid signaling. In the nuclearpathway, estrogen binds either ERalpha or ERbeta, which in turn translocates to the nucleus, binds DNA at ERE elements and activates the expression of ERE-dependent genes. In membranepathway, Estrogen can exert its actions through a subpopulation of ER at the plasma membrane (mER) or novel G-protein coupled E2 receptors (GPER). Upon activation of these receptors various signaling pathways (i.e. Ca2+, cAMP, protein kinase cascades) are rapidly activated and ultimately influence downstream transcription factors. hsa04921 Oxytocin signaling pathway Oxytocin (OT) is a nonapeptide synthesized by the magno-cellular neurons located in the supraoptic (SON) and paraventricular (PVN) nuclei of the hypothalamus. It exerts a wide variety of central and peripheral effects. However, its best-known and most well-established roles are stimulation of uterine contractions during parturition and milk release during lactation. Oxytocin also influences cardiovascular regulation and various social behaviors. The actions of OT are all mediated by one type of OT receptor (OTR). This is a transmembrane receptor belonging to the G-protein-coupled receptor superfamily. The main signaling pathway is the Gq/PLC/Ins3 pathway, but the MAPK and the RhoA/Rho kinase pathways are also activated, contributing to increased prostaglandin production and direct contractile effect on myometrial cells. In the cardiovascular system, OTR is associated with the ANP-cGMP and NO-cGMP pathways, which reduce the force and rate of contraction and increase vasodilatation. hsa04926 Relaxin signaling pathway Human relaxin-2 (relaxin), originally identified as a peptidic hormone of pregnancy, is now known to exert a range of pleiotropic effects including vasodilatory, anti-fibrotic and angiogenic effects in both males and females. It belongs to the so-called relaxin peptide family which includes the insulin-like peptides INSL3 and INSL5, and relaxin-3 (H3) as well as relaxin. INSL3 has clearly defined specialist roles in male and female reproduction, relaxin-3 is primarily a neuropeptide involved in stress and metabolic control, and INSL5 is widely distributed particularly in the gastrointestinal tract. These members of relaxin peptide family exert such effects binding to different kinds of receptors, classified as relaxin family peptide (RXFP) receptors: RXFP1, RXFP2, RXFP3, and RXFP4. These G protein-coupled receptors predominantly bind relaxin, INSL3, relaxin-3, and INSL-5, respectively. RXFP1 activates a wide spectrum of signaling pathways to generate second messengers that include cAMP and nitric oxide, whereas RXFP2 activates a subset of these pathways. Both RXFP3 and RXFP4 inhibit cAMP production, and RXFP3 activate MAP kinases. hsa04932 Non-alcoholic fatty liver disease (NAFLD) Non-alcoholic fatty liver disease (NAFLD) represents a spectrum ranging from simple steatosis to more severe steatohepatitis with hepatic inflammation and fibrosis, known as nonalcoholic steatohepatitis (NASH). NASH may further lead to cirrhosis and hepatocellular carcinoma (HCC). This map shows a stage-dependent progression of NAFLD. In the first stage of NAFLD, excess lipid accumulation has been demonstrated. The main cause is the induction of insulin resistance, which leads to a defect in insulin suppression of free fatty acids (FAAs) disposal. In addition, two transcription factors, SREBP-1c and PPAR-alpha, activate key enzymes of lipogenesis and increase the synthesis of FAAs in liver. In the second stage, as a consequence of the progression to NASH, the production of reactive oxygen species (ROS) is enhanced due to oxidation stress through mitochondrial beta-oxidation of fatty acids and endoplamic reticulum (ER) stress, leading to lipid peroxidation. The lipid peroxidation can further cause the production of cytokines (Fas ligand, TNF-alpha, IL-8 and TGF), promoting cell death, inflammation and fibrosis. The activation of JNK, which is induced by ER stress, TNF-alpha and FAAs, is also associated with NAFLD progression. Increased JNK promotes cytokine production and initiation of HCC. hsa04933 AGE-RAGE signaling pathway in diabetic complications Advanced glycation end products (AGEs) are a complex group of compounds produced through the non-enzymatic glycation and oxidation of proteins, lipids and nucleic acids, primarily due to aging and under certain pathologic condition such as huperglycemia. Some of the best chemically characterized AGEs include N-epsilon-carboxy-methyl-lysine (CML), N-epsilon-carboxy-ethyl-lysine (CEL), and Imidazolone. The major receptor for AGEs, known as receptor for advanced glycation end products (RAGE or AGER), belongs to the immunoglobulin superfamily and has been described as a pattern recognition receptor. AGE/RAGE signaling elicits activation of multiple intracellular signal pathways involving NADPH oxidase, protein kinase C, and MAPKs, then resulting in NF-kappaB activity. NF-kappa B promotes the expression of pro-inflammatory cytokines such as IL-1, IL-6 and TNF-alpha and a variety of atherosclerosis-related genes, including VCAM-1, tissue factor, VEGF, and RAGE. In addition, JAK-STAT-mediated and PI3K-Akt-dependent pathways are induced via RAGE, which in turn participate in cell proliferation and apoptosis respectively. Hypoxia-mediated induction of Egr-1 was also shown to require the AGE-RAGE interaction. The results of these signal transductions have been reported to be the possible mechanism that initates diabetic complications. hsa05030 Cocaine addiction Drug addiction is a chronic, relapsing disorder in which compulsive drug-seeking and drug-taking behavior persists despite serious negative consequences.There is strong evidence that the dopaminergic system that projects from the ventral tegmental area (VTA) of the midbrain to the nucleus accumbens (NAc), and to other forebrain sites, is the major substrate of reward and reinforcement for both natural rewards and addictive drugs. Cocaine binds strongly to the dopamine-reuptake transporter, preventing the reuptake of dopamine into the nerve terminal. Because of this blocking effect, dopamine remains at high concentrations in the synapse and continues to affect adjacent neurons, producing the characteristic cocaine high.Activated D1 receptor activates the PKA signaling pathway, and this pathway plays a critical role in mediating the behavioral responses to cocaine administration. Cocaine-induced neuroadaptations, including dopamine depletion, may underlie craving and hedonic dysregulation. hsa05031 Amphetamine addiction Amphetamine is a psychostimulant drug that exerts persistent addictive effects. Most addictive drugs increase extracellular concentrations of dopamine (DA) in nucleus accumbens (NAc) and medial prefrontal cortex (mPFC), projection areas of mesocorticolimbic DA neurons and key components of the brain reward circuit. Amphetamine achieves this elevation in extracellular levels of DA by promoting efflux from synaptic terminals. Acute administration of amphetamine induces phosphorylation of cAMP response element-binding protein (CREB) and expression of a number of immediate early genes (IEGs), such as c-fos. The IEGs is likely to initiate downstream molecular events, which may have important roles in the induction and maintenance of addictive states. Chronic exposure to amphetamine induces a unique transcription factor delta FosB, which plays an essential role in long-term adaptive changes in the brain. hsa05120 Epithelial cell signaling in Helicobacter pylori infection Two major virulence factors of H. pylori are the vacuolating cytotoxin (VacA) and the cag type-IV secretion system (T4SS) and its translocated effector protein, cytotoxin-associated antigen A (CagA).VacA binds to lipid rafts and glycosylphosphatidylinositol-anchored proteins (GPI-APs) of the target cell membrane. After insertion into the plasma membrane, VacA channels are endocytosed and eventually reach late endosomal compartments, increasing their permeability to anions with enhancement of the electrogenic vacuolar ATPase (v-ATPase) proton pump. In the presence of weak bases, osmotically active acidotropic ions will accumulate in the endosomes. This leads to water influx and vesicle swelling, an essential step in vacuole formation. In addition, it is reported that the VacA cleavage product binds to the tyrosine phosphatase receptor zeta (Ptprz) on epithelial cells and the induced signaling leads to the phosphorylation of the G protein-coupled receptor kinase-interactor 1 (Git1) and induces ulcerogenesis in mice.The other virulence factor cag T4SS mediates the translocation of the effector protein CagA, which is subsequently phosphorylated by a Src kinase. Phosphorylated CagA interacts with the protein tyrosine phosphatase SHP-2, thus stimulating its phosphatase activity. Activated SHP-2 is able to induce MAPK signalling through Ras/Raf-dependent and -independent mechanisms. Deregulation of this pathway by CagA may lead to abnormal proliferation and movement of gastric epithelial cells. hsa05132 Salmonella infection Salmonella infection usually presents as a self-limiting gastroenteritis or the more severe typhoid fever and bacteremia. The common disease-causing Salmonella species in human is a single species, Salmonella enterica, which has numerous serovars.Following intestinal colonization Salmonella inject effector proteins into the host cells using a type III secretion system (T3SS), T3SS1. Then a small group of effector proteins induce rearrangement of the actin cytoskeleton resulting in membrane ruffles and rapid internalization of the bacteria.The T3SS2 is responsible for translocating effector proteins that direct Salmonella-containing vacuole (SCV) maturation. The majority of the bacteria are known to survive and replicate in SCV. hsa05133 Pertussis Pertussis, also known as whooping cough, is an acute respiratory infectious disease caused by a bacteria called Bordetella Pertussis. The characteristic symptoms are paroxysmal cough, inspiratory wheezing and post-tussive vomiting.Following the inhalation of respiratory secretions from an infected individual, bacteria enter the upper respiratory tract and adhere to epithelial cells. Several adhesion factors have been implicated: the filamentous hemagglutinin (FHA), fimbriae, and pertactin (Prn).Pertussis toxin (Ptx) and adenylate cyclase toxin (ACT) have been identified so far as major protein toxins of B. pertussis. PTX is a hexameric AB5-type exotoxin. Catalytic A subunit catalyzes the ADP-ribosylation of the Gi subunits of the heterotrimeric G protein, then inhibits multiple downstream pathways. ACT is able to penetrate the cytoplasmic membrane of host cells and becomes activated through the cleavage and the binding of calmodulin (CaM). Activated ACT converts ATP to cyclic AMP and subverts cellular signaling pathways. hsa05140 Leishmaniasis Leishmania is an intracellular protozoan parasite of macrophages that causes visceral, mucosal, and cutaneous diseases. The parasite is transmitted to humans by sandflies, where they survive and proliferate intracellularly by deactivating the macrophage. Successful infection of Leishmania is achieved by alteration of signaling events in the host cell, leading to enhanced production of the autoinhibitory molecules like TGF-beta and decreased induction of cytokines such as IL12 for protective immunity. Nitric oxide production is also inhibited. In addition, defective expression of major histocompatibility complex (MHC) genes silences subsequent T cell activation mediated by macrophages, resulting in abnormal immune responses. hsa05142 Chagas disease (American trypanosomiasis) Trypanosoma cruzi is an intracellular protozoan parasite that causes Chagas disease. The parasite life cycle involves hematophagous reduviid bugs as vectors. Once parasites enter the host body, they invade diverse host cells including cardiomyocytes. Establishment of infection depends on various parasite molecules such as cruzipain, oligopeptidase B, and trans-sialidase that activate Ca2+ signaling. Internalized parasites escape from the parasitophorous vacuole using secreted pore-forming TcTOX molecule and replicate in the cytosol. Multiplied parasites eventually lyse infected host cells and are released in the circulation. During these events, the parasites manipulate host innate immunity and elicit cardiomyocyte hypertrophy. T lymphocyte responses are also disturbed. hsa05161 Hepatitis B Hepatitis B virus (HBV) is an enveloped virus and contains a partially double-stranded relaxed circular DNA (RC-DNA) genome. After entry into hepatocytes, HBV RC-DNA is transported to the nucleus and converted into a covalently closed circular molecule cccDNA. The cccDNA is the template for transcription of all viral RNAs including the pregenomic RNA (pgRNA), encoding for 7 viral proteins: large, middle, and small envelope proteins (LHBs, MHBs, and SHBs) that form the surface antigen (HBsAg), the core antigen (HBcAg), the e antigen (HBeAg), the HBV polymerase, and the regulatory protein X (HBx). The pgRNA interacts with the viral polymerase protein to initiate the encapsidation into the core particles. Through endoplasmic reticulum, the core particles finish assembling with the envelope proteins and are released. HBV infection leads to a wide spectrum of liver diseases raging from chronic hepatitis, cirrhosis to hepatocellular carcinoma. The mechanism of liver injury is still not clear. However, HBV proteins target host proteins, involved in a variety of functions, thus regulating transcription, cellular signaling cascades, proliferation, differentiation, and apoptosis. hsa05164 Influenza A Influenza is a contagious respiratory disease caused by influenza virus infection. Influenza A virus is responsible for both annual seasonal epidemics and periodic worldwide pandemics. Novel strains that cause pandemics arise from avian influenza virus by genetic reassortment among influenza viruses and two surface glycoproteins HA and NA form the basis of serologically distinct virus types. The innate immune system recognizes invaded virus through multiple mechanisms. Viral non-structural NS1 protein is a multifunctional virulence factor that interfere IFN-mediated antiviral response. It inhibits IFN production by blocking activation of transcription factors such as NF-kappa B, IRF3 and AP1. NS1 further inhibits the activation of IFN-induced antiviral genes. PB1-F2 protein is another virulence factor that induce apoptosis of infected cells, which results in life-threatening bronchiolitis. hsa05166 Human T-cell leukemia virus 1 infection Human T-cell leukemia virus type 1 (HTLV-1) is a pathogenic retrovirus that is associated with adult T-cell leukemia/lymphoma (ATL). It is also strongly implicated in non-neoplastic chronic inflammatory diseases such as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Expression of Tax, a viral regulatory protein is critical to the pathogenesis. Tax is a transcriptional co-factor that interfere several signaling pathways related to anti-apoptosis or cell proliferation. The modulation of the signaling by Tax involve its binding to transcription factors like CREB/ATF, NF-kappa B, SRF, and NFAT. hsa05167 Kaposi sarcoma-associated herpesvirus infection Kaposi sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus 8 (HHV-8), is the most recently identified human tumor virus, and is associated with the pathogenesis of Kaposi's sarcoma (KS), primary effusion lymphoma (PEL), and Multicentric Castleman's disease (MCD). Like all other herpesviruses, KSHV displays two modes of life cycle, latency and lytic replication, which are characterized by the patterns of viral gene expression. Genes expressed in latency (LANA, v-cyclin, v-FLIP, Kaposins A, B and C and viral miRNAs) are mainly thought to facilitate the establishment of life long latency in its host and survival against the host innate, and adaptive immune surveillance mechanisms. Among the viral proteins shown to be expressed during lytic replication are potent signaling molecules such as vGPCR, vIL6, vIRFs, vCCLs, K1 and K15, which have been implicated experimentally in the angiogenic and inflammatory phenotype observed in KS lesions. Several of these latent viral and lytic proteins are known to transform host cells, linking KSHV with the development of severe human malignancies. hsa05168 Herpes simplex infection Herpes simplex virus (HSV) infections are very common worldwide, with the prevalence of HSV-1 reaching up to 80%-90%. Primary infection with HSV takes place in the mucosa, followed by the establishment of latent infection in neuronal ganglia. HSV is the main cause of herpes infections that lead to the formation of characteristic blistering lesion. HSV express multiple viral accessory proteins that interfere with host immune responses and are indispensable for viral replication. Among these proteins, the immediate early (IE) gene ICP0, ICP4, and ICP27 are essential for regulation of HSV gene expression in productive infection. On the other hand, ORF P and ORF O gene are transcribed during latency and blocks the expression of the IE genes, thus maintaining latent infection. hsa05169 Epstein-Barr virus infection Epstein-Barr virus (EBV) is a gamma-herpes virus that widely infects human populations predominantly at an early age but remains mostly asymptomatic. EBV has been linked to a wide spectrum of human malignancies, including nasopharyngeal carcinoma and other hematologic cancers, like Hodgkin's lymphoma, Burkitt's lymphoma (BL), B-cell immunoblastic lymphoma in HIV patients, and posttransplant-associated lymphoproliferative diseases. EBV has the unique ability to establish life-long latent infection in primary human B lymphocytes. During latent infection, EBV expresses a small subset of genes, including 6 nuclear antigens (EBNA-1, -2, -3A, -3B, -3C, and -LP), 3 latent membrane proteins (LMP-1, -2A, and -2B), 2 small noncoding RNAs (EBER-1 and 2). On the basis of these latent gene expression, three different latency patterns associated with the types of cancers are recognized. hsa05170 Human immunodeficiency virus 1 infection Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time. hsa05200 Pathways in cancer hsa05203 Viral carcinogenesis There is a strong association between viruses and the development of human malignancies. We now know that at least six human viruses, Epstein-Barr virus (EBV), hepatitis B virus (HBV), hepatitis C virus (HCV), human papilloma virus (HPV), human T-cell lymphotropic virus (HTLV-1) and Kaposi's associated sarcoma virus (KSHV) contribute to 10-15% of the cancers worldwide. Via expression of many potent oncoproteins, these tumor viruses promote an aberrant cell-proliferation via modulating cellular cell-signaling pathways and escape from cellular defense system such as blocking apoptosis. Human tumor virus oncoproteins can also disrupt pathways that are necessary for the maintenance of the integrity of host cellular genome. Viruses that encode such activities can contribute to initiation as well as progression of human cancers. hsa05210 Colorectal cancer Colorectal cancer (CRC) is the second largest cause of cancer-related deaths in Western countries. CRC arises from the colorectal epithelium as a result of the accumulation of genetic alterations in defined oncogenes and tumour suppressor genes (TSG). Two major mechanisms of genomic instability have been identified in sporadic CRC progression. The first, known as chromosomal instability (CIN), results from a series of genetic changes that involve the activation of oncogenes such as K-ras and inactivation of TSG such as p53, DCC/Smad4, and APC. The second, known as microsatellite instability (MSI), results from inactivation of the DNA mismatch repair genes MLH1 and/or MSH2 by hypermethylation of their promoter, and secondary mutation of genes with coding microsatellites, such as transforming growth factor receptor II (TGF-RII) and BAX. Hereditary syndromes have germline mutations in specific genes (mutation in the tumour suppressor gene APC on chromosome 5q in FAP, mutated DNA mismatch repair genes in HNPCC). hsa05211 Renal cell carcinoma Renal cell cancer (RCC) accounts for ~3% of human malignancies and its incidence appears to be rising. Although most cases of RCC seem to occur sporadically, an inherited predisposition to renal cancer accounts for 1-4% of cases. RCC is not a single disease, it has several morphological subtypes. Conventional RCC (clear cell RCC) accounts for ~80% of cases, followed by papillary RCC (10-15%), chromophobe RCC (5%), and collecting duct RCC (<1%). Genes potentially involved in sporadic neoplasms of each particular type are VHL, MET, BHD, and FH respectively. In the absence of VHL, hypoxia-inducible factor alpha (HIF-alpha) accumulates, leading to production of several growth factors, including vascular endothelial growth factor and platelet-derived growth factor. Activated MET mediates a number of biological effects including motility, invasion of extracellular matrix, cellular transformation, prevention of apoptosis and metastasis formation. Loss of functional FH leads to accumulation of fumarate in the cell, triggering inhibition of HPH and preventing targeted pVHL-mediated degradation of HIF-alpha. BHD mutations cause the Birt-Hogg-Dube syndrome and its associated chromophobe, hybrid oncocytic, and conventional (clear cell) RCC. hsa05224 Breast cancer Breast cancer is the leading cause of cancer death among women worldwide. The vast majority of breast cancers are carcinomas that originate from cells lining the milk-forming ducts of the mammary gland. The molecular subtypes of breast cancer, which are based on the presence or absence of hormone receptors (estrogen and progesterone subtypes) and human epidermal growth factor receptor-2 (HER2), include: hormone receptor positive and HER2 negative (luminal A subtype), hormone receptor positive and HER2 positive (luminal B subtype), hormone receptor negative and HER2 positive (HER2 positive), and hormone receptor negative and HER2 negative (basal-like or triple-negative breast cancers (TNBCs)). Hormone receptor positive breast cancers are largely driven by the estrogen/ER pathway. In HER2 positive breast tumours, HER2 activates the PI3K/AKT and the RAS/RAF/MAPK pathways, and stimulate cell growth, survival and differentiation. In patients suffering from TNBC, the deregulation of various signalling pathways (Notch and Wnt/beta-catenin), EGFR protein have been confirmed. In the case of breast cancer only 8% of all cancers are hereditary, a phenomenon linked to genetic changes in BRCA1 or BRCA2. Somatic mutations in only three genes (TP53, PIK3CA and GATA3) occurred at >10% incidence across all breast cancers. hsa05231 Choline metabolism in cancer Abnormal choline metabolism is emerging as a metabolic hallmark that is associated with oncogenesis and tumour progression. Following transformation, oncogenic signalling via pathways such as the RAS and PI3K-AKT pathways, and transcription factors associated with oncogenesis such as hypoxia-inducible factor 1 (HIF1) mediate overexpression and activation of choline cycle enzymes, which causes increased levels of choline-containing precursors and breakdown products of membrane phospholipids. These products of choline phospholipid metabolism, such as phosphocholine (PCho), diacylglycerol (DAG) and phosphatidic acid, may function as second messengers that are essential for the mitogenic activity of growth factors, particularly in the activation of the ras-raf-1-MAPK cascade and protein kinase C pathway. hsa05321 Inflammatory bowel disease (IBD) Inflammatory bowel disease (IBD), which includes Crohn disease (CD) and ulcerative colitis (UC), is characterized by chronic inflammation of the gastrointestinal tract due to environmental and genetic factors, infectious microbes, and the dysregulated immune system. Although many environmental factors (for example, geographic locations, smoking, etc.) affect the development of IBD, the most crucial might be the luminal (external) environment of the epithelial cells. There are pathogens that are found in increasing frequency in IBD. The microbial components such as flagellin, peptidoglycan, and lipopolysaccharide are recognized by receptors such as toll-like receptors (TLRs) and nucleotide-binding oligomerization domain (NOD) proteins, and also by antigen-presenting cells (APCs) in genetically susceptible host. The TLR recognition triggers the activation of NF-kappaB, leading to an inflammatory response. APC-expressed gene NOD2 has been associated with Crohn disease. In case of mutations of NOD2, negative regulation of IL-12 production is reduced with the stimulation of muramyl dipeptide (MDP), leading to CD. In addition, the APC mediates the differentiation of naive T cells into effector T cells (Th1, Th17, Th2) and natural killer T (NKT) cells. Th1 and Th17 cells produce high levels of IFN-gamma and IL-17, -22, respectively, both of which promote CD. In contrast, Th2 cells produce IL-4, -5, -10, which together with IL-13 from NKT induce UC. hsa05323 Rheumatoid arthritis Rheumatoid arthritis (RA) is a chronic autoimmune joint disease where persistent inflammation affects bone remodeling leading to progressive bone destruction. In RA, abnormal activation of the immune system elevates pro-inflammatory cytokines and chemokines levels, which can promote synovial angiogenesis and leukocyte infiltration. The synovium forms a hyperplastic pannus with infiltrated macrophage-like and fibroblast-like synoviocytes and invades joints by secreting proteinases and inducing osteoclast differentiation. hsa05418 Fluid shear stress and atherosclerosis Shear stress represents the frictional force that the flow of blood exerts at the endothelial surface of the vessel wall and plays a central role in vascular biology and contributes to the progress of atherosclerosis. Sustained laminar flow with high shear stress upregulates expressions of endothelial cell (EC) genes and proteins that are protective against atherosclerosis. The key shear stress-induced transcription factors that govern the expression of these genes are Kruppel-like factor 2 (KLF2) and nuclear factor erythroid 2-like 2 (Nrf2). On the other hand, disturbed flow with associated reciprocating, low shear stress generally upregulates the EC genes and proteins that promote oxidative and inflammatory states in the artery wall, resulting in atherogenesis. Important transcriptional events that reflect this condition of ECs in disturbed flow include the activation of activator protein 1 (AP-1) and nuclear factor kappaB (NF-kappaB).
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1912408 Pre-NOTCH Transcription and Translation. In humans, the NOTCH protein family has four members: NOTCH1, NOTCH2, NOTCH3 and NOTCH4. NOTCH1 protein was identified first, as the product of a chromosome 9 gene translocated in T-cell acute lymphoblastic leukemia that was homologous to Drosophila Notch (Ellisen et al. 1991). At the same time, rat Notch1 was cloned (Weinmaster et al. 1991), followed by cloning of mouse Notch1, named Motch (Del Amo et al. 1992). NOTCH2 protein is the product of a gene on chromosome 1 (Larsson et al. 1994). NOTCH2 expression is differentially regulated during B-cell development (Bertrand et al. 2000). NOTCH2 mutations are a rare cause of Alagille syndrome (McDaniell et al. 2006). NOTCH3 is the product of a gene on chromosome 19. NOTCH3 mutations are the underlying cause of CADASIL, cerebral arteriopathy with subcortical infarcts and leukoencephalopathy (Joutel et al. 1996). NOTCH4, the last NOTCH protein discovered, is the product of a gene on chromosome 6 (Li et al. 1998). MicroRNAs play an important negative role in translation and/or stability of NOTCH mRNAs. MicroRNAs miR-34 (miR-34A, miR-34B and mi-R34C), whose transcription is directly induced by the tumor suppressor protein p53 (Chang et al. 2007, Raver-Shapira et al. 2007, He et al. 2007, Corney et al. 2007) bind and negatively regulate translation of NOTCH1 mRNA (Li et al. 2009, Pang et al. 2010, Ji et al. 2009) and NOTCH2 mRNA (Li et al. 2009). NOTCH1 mRNA translation is also negatively regulated by microRNAs miR-200B and miR-200C (Kong et al. 2010), as well as miR-449A, miR-449B and miR-449C (Marcet et al. 2011). Translation of NOTCH3 mRNA is negatively regulated by microRNAs miR-150 (Ghisi et al. 2011) and miR-206 (Song et al. 2009). Translation of NOTCH4 mRNA is negatively regulated by microRNAs miR-181C (Hashimoto et al. 2010) and miR-302A (Costa et al. 2009). Nascent NOTCH peptides are co-translationally targeted to the endoplasmic reticulum for further processing, followed by modification in the Golgi apparatus, before trafficking to the plasma membrane. Endoplasmic reticulum calcium ATPases, positively regulate NOTCH trafficking, possibly by contributing to accurate folding of NOTCH precursors (Periz et al. 1999) R-HSA-2559580 Oxidative Stress Induced Senescence. Oxidative stress, caused by increased concentration of reactive oxygen species (ROS) in the cell, can happen as a consequence of mitochondrial dysfunction induced by the oncogenic RAS (Moiseeva et al. 2009) or independent of oncogenic signaling. Prolonged exposure to interferon-beta (IFNB, IFN-beta) also results in ROS increase (Moiseeva et al. 2006). ROS oxidize thioredoxin (TXN), which causes TXN to dissociate from the N-terminus of MAP3K5 (ASK1), enabling MAP3K5 to become catalytically active (Saitoh et al. 1998). ROS also stimulate expression of Ste20 family kinases MINK1 (MINK) and TNIK through an unknown mechanism, and MINK1 and TNIK positively regulate MAP3K5 activation (Nicke et al. 2005). MAP3K5 phosphorylates and activates MAP2K3 (MKK3) and MAP2K6 (MKK6) (Ichijo et al. 1997, Takekawa et al. 2005), which act as p38 MAPK kinases, as well as MAP2K4 (SEK1) (Ichijo et al. 1997, Matsuura et al. 2002), which, together with MAP2K7 (MKK7), acts as a JNK kinase.
MKK3 and MKK6 phosphorylate and activate p38 MAPK alpha (MAPK14) and beta (MAPK11) (Raingeaud et al. 1996), enabling p38 MAPKs to phosphorylate and activate MAPKAPK2 (MK2) and MAPKAPK3 (MK3) (Ben-Levy et al. 1995, Clifton et al. 1996, McLaughlin et al. 1996, Sithanandam et al. 1996, Meng et al. 2002, Lukas et al. 2004, White et al. 2007), as well as MAPKAPK5 (PRAK) (New et al. 1998 and 2003, Sun et al. 2007).
Phosphorylation of JNKs (MAPK8, MAPK9 and MAPK10) by MAP3K5-activated MAP2K4 (Deacon and Blank 1997, Fleming et al. 2000) allows JNKs to migrate to the nucleus (Mizukami et al. 1997) where they phosphorylate JUN. Phosphorylated JUN binds FOS phosphorylated by ERK1 or ERK2, downstream of activated RAS (Okazaki and Sagata 1995, Murphy et al. 2002), forming the activated protein 1 (AP-1) complex (FOS:JUN heterodimer) (Glover and Harrison 1995, Ainbinder et al. 1997).
Activation of p38 MAPKs and JNKs downstream of MAP3K5 (ASK1) ultimately converges on transcriptional regulation of CDKN2A locus. In dividing cells, nucleosomes bound to the CDKN2A locus are trimethylated on lysine residue 28 of histone H3 (HIST1H3A) by the Polycomb repressor complex 2 (PRC2), creating the H3K27Me3 (Me3K-28-HIST1H3A) mark (Bracken et al. 2007, Kotake et al. 2007). The expression of Polycomb constituents of PRC2 (Kuzmichev et al. 2002) - EZH2, EED and SUZ12 - and thereby formation of the PRC2, is positively regulated in growing cells by E2F1, E2F2 and E2F3 (Weinmann et al. 2001, Bracken et al. 2003). H3K27Me3 mark serves as a docking site for the Polycomb repressor complex 1 (PRC1) that contains BMI1 (PCGF4) and is therefore named PRC1.4, leading to the repression of transcription of p16-INK4A and p14-ARF from the CDKN2A locus, where PCR1.4 mediated repression of p14-ARF transcription in humans may be context dependent (Voncken et al. 2005, Dietrich et al. 2007, Agherbi et al. 2009, Gao et al. 2012). MAPKAPK2 and MAPKAPK3, activated downstream of the MAP3K5-p38 MAPK cascade, phosphorylate BMI1 of the PRC1.4 complex, leading to dissociation of PRC1.4 complex from the CDKN2A locus and upregulation of p14-ARF transcription (Voncken et al. 2005). AP-1 transcription factor, formed as a result of MAP3K5-JNK signaling, as well as RAS signaling, binds the promoter of KDM6B (JMJD3) gene and stimulates KDM6B expression. KDM6B is a histone demethylase that removes H3K27Me3 mark i.e. demethylates lysine K28 of HIST1H3A, thereby preventing PRC1.4 binding to the CDKN2A locus and allowing transcription of p16-INK4A (Agger et al. 2009, Barradas et al. 2009, Lin et al. 2012).
p16-INK4A inhibits phosphorylation-mediated inactivation of RB family members by CDK4 and CDK6, leading to cell cycle arrest (Serrano et al. 1993). p14-ARF inhibits MDM2-mediated degradation of TP53 (p53) (Zhang et al. 1998), which also contributes to cell cycle arrest in cells undergoing oxidative stress. In addition, phosphorylation of TP53 by MAPKAPK5 (PRAK) activated downstream of MAP3K5-p38 MAPK signaling, activates TP53 and contributes to cellular senescence (Sun et al. 2007)
R-HSA-2559582 Senescence-Associated Secretory Phenotype (SASP). The culture medium of senescent cells in enriched in secreted proteins when compared with the culture medium of quiescent i.e. presenescent cells and these secreted proteins constitute the so-called senescence-associated secretory phenotype (SASP), also known as the senescence messaging secretome (SMS). SASP components include inflammatory and immune-modulatory cytokines (e.g. IL6 and IL8), growth factors (e.g. IGFBPs), shed cell surface molecules (e.g. TNF receptors) and survival factors. While the SASP exhibits a wide ranging profile, it is not significantly affected by the type of senescence trigger (oncogenic signalling, oxidative stress or DNA damage) or the cell type (epithelial vs. mesenchymal) (Coppe et al. 2008). However, as both oxidative stress and oncogenic signaling induce DNA damage, the persistent DNA damage may be a deciding SASP initiator (Rodier et al. 2009). SASP components function in an autocrine manner, reinforcing the senescent phenotype (Kuilman et al. 2008, Acosta et al. 2008), and in the paracrine manner, where they may promote epithelial-to-mesenchymal transition (EMT) and malignancy in the nearby premalignant or malignant cells (Coppe et al. 2008). Interleukin-1-alpha (IL1A), a minor SASP component whose transcription is stimulated by the AP-1 (FOS:JUN) complex (Bailly et al. 1996), can cause paracrine senescence through IL1 and inflammasome signaling (Acosta et al. 2013).Here, transcriptional regulatory processes that mediate the SASP are annotated. DNA damage triggers ATM-mediated activation of TP53, resulting in the increased level of CDKN1A (p21). CDKN1A-mediated inhibition of CDK2 prevents phosphorylation and inactivation of the Cdh1:APC/C complex, allowing it to ubiquitinate and target for degradation EHMT1 and EHMT2 histone methyltransferases. As EHMT1 and EHMT2 methylate and silence the promoters of IL6 and IL8 genes, degradation of these methyltransferases relieves the inhibition of IL6 and IL8 transcription (Takahashi et al. 2012). In addition, oncogenic RAS signaling activates the CEBPB (C/EBP-beta) transcription factor (Nakajima et al. 1993, Lee et al. 2010), which binds promoters of IL6 and IL8 genes and stimulates their transcription (Kuilman et al. 2008, Lee et al. 2010). CEBPB also stimulates the transcription of CDKN2B (p15-INK4B), reinforcing the cell cycle arrest (Kuilman et al. 2008). CEBPB transcription factor has three isoforms, due to three alternative translation start sites. The CEBPB-1 isoform (C/EBP-beta-1) seems to be exclusively involved in growth arrest and senescence, while the CEBPB-2 (C/EBP-beta-2) isoform may promote cellular proliferation (Atwood and Sealy 2010 and 2011). IL6 signaling stimulates the transcription of CEBPB (Niehof et al. 2001), creating a positive feedback loop (Kuilman et al. 2009, Lee et al. 2010). NF-kappa-B transcription factor is also activated in senescence (Chien et al. 2011) through IL1 signaling (Jimi et al. 1996, Hartupee et al. 2008, Orjalo et al. 2009). NF-kappa-B binds IL6 and IL8 promoters and cooperates with CEBPB transcription factor in the induction of IL6 and IL8 transcription (Matsusaka et al. 1993, Acosta et al. 2008). Besides IL6 and IL8, their receptors are also upregulated in senescence (Kuilman et al. 2008, Acosta et al. 2008) and IL6 and IL8 may be master regulators of the SASP.
IGFBP7 is also an SASP component that is upregulated in response to oncogenic RAS-RAF-MAPK signaling and oxidative stress, as its transcription is directly stimulated by the AP-1 (JUN:FOS) transcription factor. IGFBP7 negatively regulates RAS-RAF (BRAF)-MAPK signaling and is important for the establishment of senescence in melanocytes (Wajapeyee et al. 2008).
Please refer to Young and Narita 2009 for a recent review
R-HSA-2871796 FCERI mediated MAPK activation. Formation of the LAT signaling complex leads to activation of MAPK and production of cytokines. The sequence of events that leads from LAT to cytokine production has not been as clearly defined as the sequence that leads to degranulation. However, the pathways that lead to cytokine production require the guanine-nucleotide-exchange factors SOS and VAV that regulate GDP-GTP exchange of RAS. After its activation, RAS positively regulates the RAF-dependent pathway that leads to phosphorylation and, in part, activation of the mitogen-activated protein kinases (MAPKs) extracellular-signal-regulated kinase 1 (ERK1) and ERK2 (Gilfillan & Tkaczyk 2006) R-HSA-450341 Activation of the AP-1 family of transcription factors. Activator protein-1 (AP-1) is a collective term referring to a group of transcription factors that bind to promoters of target genes in a sequence-specific manner. AP-1 family consists of hetero- and homodimers of bZIP (basic region leucine zipper) proteins, mainly of Jun-Jun, Jun-Fos or Jun-ATF. AP-1 members are involved in the regulation of a number of cellular processes including cell growth, proliferation, survival, apoptosis, differentiation, cell migration. The ability of a single transcription factor to determine a cell fate critically depends on the relative abundance of AP-1 subunits, the composition of AP-1 dimers, the quality of stimulus, the cell type, the co-factor assembly.
AP-1 activity is regulated on multiple levels; transcriptional, translational and post-translational control mechanisms contribute to the balanced production of AP-1 proteins and their functions. Briefly, regulation occurs through:
effects on jun, fos, atf gene transcription and mRNA turnover. AP-1 protein members turnover. post-translational modifications of AP-1 proteins that modulate their transactivation potential (effect of protein kinases or phosphatases). interactions with other transcription factors that can either induce or interfere with AP-1 activity R-HSA-5617472 Activation of anterior HOX genes in hindbrain development during early embryogenesis. In mammals, anterior Hox genes may be defined as paralog groups 1 to 4 (Natale et al. 2011), which are involved in development of the hindbrain through sequential expression in the rhombomeres, transient segments of the neural tube that form during development of the hindbrain (reviewed in Alexander et al. 2009, Soshnikova and Duboule 2009, Tumpel et al. 2009, Mallo et al. 2010, Andrey and Duboule 2014). Hox gene activation during mammalian development has been most thoroughly studied in mouse embryos and the results have been extended to human development by in vitro experiments with human embryonal carcinoma cells and human embryonic stem cells.Expression of a typical anterior Hox gene has an anterior boundary located at the junction between two rhombomeres and continues caudally to regulate segmentation and segmental fate in ectoderm, mesoderm, and endoderm. Anterior boundaries of expression of successive Hox paralog groups are generally separated from each other by 2 rhombomeres. For example, HOXB2 is expressed in rhombomere 3 (r3) and caudally while HOXB3 is expressed in r5 and caudally. Exceptions exist, however, as HOXA1, HOXA2, and HOXB1 do not follow the rule and HOXD1 and HOXC4 are not expressed in rhombomeres. Hox genes within a Hox cluster are expressed colinearly: the gene at the 3' end of the cluster is expressed earliest, and hence most anteriorly, then genes 5' are activated sequentially in the same order as they occur in the cluster. Activation of expression occurs epigenetically by loss of polycomb repressive complexes and change of bivalent chromatin to active chromatin through, in part, the actions of trithorax family proteins (reviewed in Soshnikova and Duboule 2009). Hox gene expression initiates in the posterior primitive streak that will contribute to extraembryonic mesoderm. Expression then extends anteriorly into the cells that will become the embryo, where expression is first observed in presumptive lateral plate mesoderm and is transmitted to both paraxial mesoderm and neurectoderm formed by gastrulation along the primitive streak (reviewed in Deschamps et al. 1999, Casaca et al. 2014).Prior to establishment of the rhombomeres, expression of HOXA1 and HOXB1 is initiated near the future site of r3 and caudally by a gradient of retinoic acid (RA). (Mechanisms of retinoic acid signaling are reviewed in Cunningham and Duester 2015.) The RA is generated by the ALDH1A2 (RALDH2) enzyme located in somites flanking the caudal hindbrain and degraded by CYP26 enzymes expressed initially in anterior neural ectoderm of the early gastrula and then throughout most of the hindbrain (reviewed in White and Schilling 2008). HOXA1 with PBX1,2 and MEIS2 directly activate transcription of ALDH1A2 to maintain retinoic acid synthesis in the somitic mesoderm (Vitobello et al. 2011). Differentiation of embryonal carcinoma cells and embryonic stem cells in response to retinoic acid is used to model the process of differentiation in vitro (reviewed in Soprano et al. 2007, Gudas et al. 2013).HOXA1 appears to set the anterior limit of HOXB1 expression (Barrow et al. 2000). HOXB1 initiates expression of EGR2 (KROX20) in presumptive r3. EGR2 then activates HOXA2 expression in r3 and r5 while HOXB1, together with PBX1 and MEIS:PKNOX1 (MEIS:PREP), activates expression of HOXA2 in r4 and caudal rhombomeres. AP-2 transcription factors maintain expression of HOXA2 in neural crest cells (Maconochie et al. 1999). HOXB1 also activates expression of HOXB2 in r3 and caudal rhombomeres. EGR2 negatively regulates HOXB1 so that by the time rhombomeres appear, HOXB1 is restricted to r4 and HOXA1 is no longer detectable (Barrow et al. 2000). EGR2 and MAFB (Kreisler) then activate HOXA3 and HOXB3 in r5 and caudal rhombomeres. Retinoic acid activates HOXA4, HOXB4, and HOXD4 in r7, the final rhombomere. HOX proteins, in turn, activate expression of genes in combination with other factors, notably members of the TALE family of transcription factors (PBX, PREP, and MEIS, reviewed in Schulte and Frank 2014, Rezsohazy et al. 2015). HOX proteins also participate in non-transcriptional interactions (reviewed in Rezsohazy 2014). In zebrafish, Xenopus, and chicken factors such as Meis3, Fgf3, Fgf8, and vHNF regulate anterior hox genes (reviewed in Schulte and Frank 2014), however less is known about the roles of homologous factors in mammals. Mutations in HOXA1 in humans have been observed to cause developmental abnormalities located mostly in the head and neck region (Tischfield et al. 2005, Bosley et al. 2008). A missense mutation in HOXA2 causes microtia, hearing impairment, and partially cleft palate (Alasti et al. 2008). A missense mutation in HOXB1 causes a similar phenotype to the Hoxb1 null mutation in mice: bilateral facial palsy, hearing loss, and strabismus (improper alignment of the eyes) (Webb et al. 2012) R-HSA-5687128 MAPK6/MAPK4 signaling. MAPK6 and MAPK4 (also known as ERK3 and ERK4) are vertebrate-specific atypical MAP kinases. Atypical MAPK are less well characterized than their conventional counterparts, and are generally classified as such based on their lack of activation by MAPKK family members. Unlike the conventional MAPK proteins, which contain a Thr-X-Tyr motif in the activation loop, MAPK6 and 4 have a single Ser-Glu-Gly phospho-acceptor motif (reviewed in Coulombe and Meloche, 2007; Cargnello et al, 2011). MAPK6 is also distinct in being an unstable kinase, whose turnover is mediated by ubiquitin-dependent degradation (Coulombe et al, 2003; Coulombe et al, 2004). The biological functions and pathways governing MAPK6 and 4 are not well established. MAPK6 and 4 are phosphorylated downstream of class I p21 activated kinases (PAKs) in a RAC- or CDC42-dependent manner (Deleris et al, 2008; Perander et al, 2008; Deleris et al, 2011; De La Mota-Peynado et al, 2011). One of the only well established substrates of MAPK6 and 4 is MAPKAPK5, which contributes to cell motility by promoting the HSBP1-dependent rearrangement of F-actin (Gerits et al, 2007; Kostenko et al, 2009a; reviewed in Kostenko et al, 2011b). The atypical MAPKs also contribute to cell motility and invasiveness through the NCOA3:ETV4-dependent regulation of MMP gene expression (Long et al, 2012; Yan et al, 2008; Qin et al, 2008) R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes. Several DNA repair genes contain p53 response elements and their transcription is positively regulated by TP53 (p53). TP53-mediated regulation probably ensures increased protein level of DNA repair genes under genotoxic stress.TP53 directly stimulates transcription of several genes involved in DNA mismatch repair, including MSH2 (Scherer et al. 2000, Warnick et al. 2001), PMS2 and MLH1 (Chen and Sadowski 2005). TP53 also directly stimulates transcription of DDB2, involved in nucleotide excision repair (Tan and Chu 2002), and FANCC, involved in the Fanconi anemia pathway that repairs DNA interstrand crosslinks (Liebetrau et al. 1997). Other p53 targets that can influence DNA repair functions are RRM2B (Kuo et al. 2012), XPC (Fitch et al. 2003), GADD45A (Amundson et al. 2002), CDKN1A (Cazzalini et al. 2010) and PCNA (Xu and Morris 1999). Interestingly, the responsiveness of some of these DNA repair genes to p53 activation has been shown in human cells but not for orthologous mouse genes (Jegga et al. 2008, Tan and Chu 2002). Contrary to the positive modulation of nucleotide excision repair (NER) and mismatch repair (MMR), p53 can negatively modulate base excision repair (BER), by down-regulating the endonuclease APEX1 (APE1), acting in concert with SP1 (Poletto et al. 2016).
Expression of several DNA repair genes is under indirect TP53 control, through TP53-mediated stimulation of cyclin K (CCNK) expression (Mori et al. 2002). CCNK is the activating cyclin for CDK12 and CDK13 (Blazek et al. 2013). The complex of CCNK and CDK12 binds and phosphorylates the C-terminal domain of the RNA polymerase II subunit POLR2A, which is necessary for efficient transcription of long DNA repair genes, including BRCA1, ATR, FANCD2, FANCI, ATM, MDC1, CHEK1 and RAD51D. Genes whose transcription is regulated by the complex of CCNK and CDK12 are mainly involved in the repair of DNA double strand breaks and/or the Fanconi anemia pathway (Blazek et al. 2011, Cheng et al. 2012, Bosken et al. 2014, Bartkowiak and Greenleaf 2015, Ekumi et al. 2015)
R-HSA-8862803 Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models. Post-mitotic neurons do not have an active cell cycle. However, deregulation of Cyclin Dependent Kinase-5 (CDK5) activity in these neurons can aberrantly activate various components of cell cycle leading to neuronal death (Chang et al. 2012). Random activation of cell cycle proteins has been shown to play a key role in the pathogenesis of several neurodegenerative disorders (Yang et al. 2003, Lopes et al. 2009). CDK5 is not activated by the canonical cyclins, but binds to its own specific partners, CDK5R1 and CDK5R2 (aka p35 and p39, respectively) (Tsai et al. 1994, Tang et al. 1995). Expression of p35 is nearly ubiquitous, whereas p39 is largely expressed in the central nervous system. A variety of neurotoxic insults such as beta-amyloid (A-beta), ischemia, excitotoxicity and oxidative stress disrupt the intracellular calcium homeostasis in neurons, thereby leading to the activation of calpain, which cleaves p35 into p25 and p10 (Lee et al. 2000). p25 has a six-fold longer half-life compared to p35 and lacks the membrane anchoring signal, which results in its constitutive activation and mislocalization of the CDK5:p25 complex to the cytoplasm and the nucleus. There, CDK5:p25 is able to access and phosphorylate a variety of atypical targets, triggering a cascade of neurotoxic pathways that culminate in neuronal death. One such neurotoxic pathway involves CDK5-mediated random activation of cell cycle proteins which culminate in neuronal death. Exposure of primary cortical neurons to oligomeric beta-amyloid (1-42) hyper-activates CDK5 due to p25 formation, which in turn phosphorylates CDC25A, CDC25B and CDC25C. CDK5 phosphorylates CDC25A at S40, S116 and S261; CDC25B at S50, T69, S160, S321 and S470; and CDC25C at T48, T67, S122, T130, S168 and S214. CDK5-mediated phosphorylation of CDC25A, CDC25B and CDC25C not only increases their phosphatase activities but also facilitates their release from 14-3-3 inhibitory binding. CDC25A, CDC25B and CDC25C in turn activate CDK1, CDK2 and CDK4 kinases causing neuronal death. Consistent with this mechanism, higher CDC25A, CDC25B and CDC25C activities were observed in human Alzheimer's disease (AD) clinical samples, as compared to age-matched controls R-HSA-8943724 Regulation of PTEN gene transcription. Transcription of the PTEN gene is regulated at multiple levels. Epigenetic repression involves the recruitment of Mi-2/NuRD upon SALL4 binding to the PTEN promoter (Yang et al. 2008, Lu et al. 2009) or EVI1-mediated recruitment of the polycomb repressor complex (PRC) to the PTEN promoter (Song et al. 2009, Yoshimi et al. 2011). Transcriptional regulation is also elicited by negative regulators, including NR2E1:ATN1 (atrophin-1) complex, JUN (c-Jun), SNAIL and SLUG (Zhang et al. 2006, Vasudevan et al. 2007, Escriva et al. 2008, Uygur et al. 2015) and positive regulators such as TP53 (p53), MAF1, ATF2, EGR1 or PPARG (Stambolic et al. 2001, Virolle et al. 2001, Patel et al. 2001, Shen et al. 2006, Li et al. 2016) R-HSA-9018519 Estrogen-dependent gene expression. Estrogens mediate their transcriptional effects through interaction with the estrogen receptors, ESR1 (also known as ER alpha) and ESR2 (ER beta). ESR1 and ESR2 share overlapping but distinct functions, with ESR1 playing the primary role in transcriptional activation in most cell types (Hah and Krauss, 2014; Haldosén et al, 2014. The receptors function as ligand-dependent dimers and can activate target genes either through direct binding to an estrogen responsive element (ERE) in the target gene promoter, or indirectly through interaction with another DNA-binding protein such as RUNX1, SP1, AP1 or NF-kappa beta (reviewed in Bai and Gust, 2009; Hah and Krause, 2014). Binding of estrogen receptors to the DNA promotes the assembly of higher order transcriptional complexes containing methyltransferases, histone acetyltransferases and other transcriptional activators, which promote transcription by establishing active chromatin marks and by recruiting general transcription factors and RNA polymerase II. ESR1- and estrogen-dependent recruitment of up to hundreds of coregulators has been demonstrated by varied co-immunoprecipitation and proteomic approaches (Kittler et al, 2013; Mohammed et al, 2013; Foulds et al, 2013; Mohammed et al, 2015; Liu et al, 2014; reviewed in Magnani and Lupien, 2014; Arnal, 2017). In some circumstances, ligand-bound receptors can also promote the assembly of a repression complex at a target gene, and in some cases, heterodimers of ESR1 and ESR2 serve as repressors of ESR1-mediated target gene activation (reviewed in Hah and Kraus, 2014; Arnal et al, 2017). Phosphorylation of the estrogen receptor also modulates its activity, and provides cross-talk between nuclear estrogen-dependent signaling and non-genomic estrogen signaling from the plasma membrane (reviewed in Anbalagan and Rowan, 2015; Halodsèn et al, 2014; Schwartz et al, 2016) A number of recent genome wide studies highlight the breadth of the transcriptional response to estrogen. The number of predicted estrogen-dependent target genes ranges from a couple of hundred (based on microarray studies) to upwards of 10000, based on ChIP-chip or ChIP-seq (Cheung and Kraus, 2010; Kinnis and Kraus, 2008; Lin et al, 2004; Welboren et al, 2009; Ikeda et al, 2015; Lin et al, 2007; Carroll et al, 2006). Many of these predicted sites may not represent transcriptionally productive binding events, however. A study examining ESR1 binding by ChIP-seq in 20 primary breast cancers identified a core of 484 ESR-binding events that were conserved in at least 75% of ER+ tumors, which may represent a more realistic estimate (Ross-Innes et al, 2012). These studies also highlight the long-range effect of estrogen receptor-binding, with distal enhancer or promoter elements regulating the expression of many target genes, often through looping or other higher order chromatin structures (Kittler et al, 2013; reviewed in Dietz and Carroll, 2008; Liu and Cheung, 2014; Magnani and Lupien, 2014). Transcription from a number of estrogen-responsive target genes also appears to be primed by the binding of pioneering transcription factors such as FOXA1, GATA3, PBX1 among others
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AHCYL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID AP1G1 Affinity Capture-Western physical 17538020 , (Europe PMC )NA BioGRID APLP2 Reconstituted Complex, Two-hybrid, display technology, two hybrid pooling approach physical, physical association 20195357 , 20936779 , (Europe PMC )0.57 BioGRID, IntAct APOA2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT APP Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct AR Affinity Capture-Western physical 9211894 , (Europe PMC )NA BioGRID ARHGAP22 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARID3B Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT ARIH1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARNT Affinity Capture-Western physical 19203995 , (Europe PMC )NA BioGRID ARNTL Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ARRB1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ATF2 Affinity Capture-MS, Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, display technology, peptide array, proximity ligation assay, tandem affinity purification association, direct interaction, physical, physical association 10207054 , 10327051 , 15546613 , 1827203 , 20102225 , 20195357 , 20511396 , 2320002 , 23661758 , 25609649 , 26496610 , 28514442 , 8027667 , (Europe PMC )0.87 BioGRID, IntAct, MINT ATF3 Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical, physical association 10327051 , 14667575 , 1827203 , 20102225 , 20304822 , 23661758 , 25609649 , 26496610 , 8622660 , (Europe PMC )0.73 BioGRID, IntAct, MINT ATF4 Co-localization, FRET, Reconstituted Complex, Two-hybrid, proximity ligation assay, two hybrid pooling approach physical, physical association 1827203 , 20936779 , 23661758 , 25241761 , (Europe PMC )0.57 BioGRID, IntAct ATF7 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26496610 , (Europe PMC )0.35, 0.64 BioGRID, IntAct, MINT BANP Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BATF FRET, peptide array direct interaction, physical 20102225 , 23661758 , (Europe PMC )0.44 BioGRID, IntAct BATF2 FRET, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical, physical association 19074269 , 23661758 , (Europe PMC )0.58 BioGRID, IntAct BATF3 Affinity Capture-MS, FRET, Reconstituted Complex, peptide array, tandem affinity purification association, direct interaction, physical 10878360 , 20102225 , 23661758 , 25609649 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct, MINT BBS7 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct BCL3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10497212 , (Europe PMC )NA BioGRID BCL6 Reconstituted Complex, Two-hybrid physical 12165517 , (Europe PMC )NA BioGRID BEND4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BLM Reconstituted Complex physical 23750012 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12080089 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT CASP9 Biochemical Activity physical 23678002 , (Europe PMC )NA BioGRID CAVIN1 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID CCDC93 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CCDC97 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCNDBP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDKN1A Affinity Capture-Western physical 20102411 , (Europe PMC )NA BioGRID CEBPA Affinity Capture-Western physical 17082780 , (Europe PMC )NA BioGRID CEBPB Affinity Capture-MS physical 25609649 , (Europe PMC )NA BioGRID CEBPE FRET physical 23661758 , (Europe PMC )NA BioGRID CEBPG FRET physical 23661758 , (Europe PMC )NA BioGRID CHD3 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 21196933 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT CLEC3A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLINT1 Protein-peptide, Reconstituted Complex physical 14675752 , (Europe PMC )NA BioGRID COP1 Affinity Capture-MS, Affinity Capture-Western physical 12615916 , 14739464 , 15994960 , 25117710 , 25609649 , 27534417 , 28514442 , (Europe PMC )NA BioGRID COPS2 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 16045761 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT COPS5 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 10766246 , 20093369 , 25609649 , 8837781 , (Europe PMC )0.35 BioGRID, IntAct, MINT CORO7 Affinity Capture-MS physical 24768539 , (Europe PMC )NA BioGRID CREB1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, tandem affinity purification association, physical 2138276 , 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT CREB3 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct CREB5 Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 25609649 , 26186194 , 26496610 , 28514442 , 8440710 , (Europe PMC )0.35, 0.46 BioGRID, IntAct, MINT CREBBP Affinity Capture-Western, Co-localization, Far Western, Reconstituted Complex physical 10327051 , 15994313 , 17296604 , 18443043 , 8028671 , 9659924 , 9786917 , (Europe PMC )NA BioGRID CSK Affinity Capture-Western, Biochemical Activity, Two-hybrid physical 16740711 , 19818398 , (Europe PMC )NA BioGRID CSNK2A1 Biochemical Activity, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12628923 , 25609649 , 9685505 , (Europe PMC )0.35 BioGRID, IntAct, MINT DACH1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation association, physical 16980615 , 17182846 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT DARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT DDIT3 Affinity Capture-Western, FRET, Reconstituted Complex physical 10523647 , 23661758 , (Europe PMC )NA BioGRID DDX21 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, experimental interaction detection, pull down association, direct interaction, physical, physical association 11823437 , 25609649 , (Europe PMC )0.67 BioGRID, IntAct, MINT DEUP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DHX9 Affinity Capture-MS physical 11823437 , (Europe PMC )NA BioGRID DNMT3L Reconstituted Complex physical 24952347 , (Europe PMC )NA BioGRID EBF3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT EDF1 Affinity Capture-Western, Reconstituted Complex, pull down physical, physical association 10567391 , 16880509 , (Europe PMC )0.40 BioGRID, IntAct EEF1D Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT EP300 Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10327051 , 11689449 , 11980644 , 12437352 , 12471036 , 14630807 , 21268080 , 21937452 , 24069158 , 24636898 , 27956703 , (Europe PMC )0.35 BioGRID, IntAct EPAS1 FRET physical 23661758 , (Europe PMC )NA BioGRID ERG Reconstituted Complex physical 11278640 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western, Reconstituted Complex physical 11477071 , 17317669 , 23747343 , (Europe PMC )NA BioGRID ETS1 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , 8557686 , (Europe PMC )0.52 BioGRID, IntAct ETS2 Reconstituted Complex, Two-hybrid physical 9334186 , (Europe PMC )NA BioGRID ETV1 Reconstituted Complex physical 14550555 , (Europe PMC )NA BioGRID ETV4 Two-hybrid physical 16786139 , (Europe PMC )NA BioGRID EWSR1 Proximity Label-MS, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14550555 , 24999758 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT EXOC1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FBXL12 Affinity Capture-Western physical 17704768 , (Europe PMC )NA BioGRID FBXW7 Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex, Two-hybrid physical 14739463 , 28036276 , (Europe PMC )NA BioGRID FOS Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Co-localization, FRET, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, circular dichroism, display technology, fluorescent resonance energy transfer, isothermal titration calorimetry, peptide array, proximity ligation assay, tandem affinity purification, two hybrid, two hybrid pooling approach, x-ray crystallography association, direct interaction, physical, physical association 10488148 , 11053448 , 11090181 , 11431474 , 15319445 , 15718494 , 15994313 , 16008525 , 16055710 , 16714286 , 16928824 , 17440114 , 18172215 , 18848838 , 20102225 , 20195357 , 20410304 , 20498278 , 20511396 , 20936779 , 21199371 , 21675959 , 22719067 , 23602568 , 23661758 , 24029232 , 25609649 , 26186194 , 26496610 , 28514442 , 7816143 , 8380166 , 8440710 , 8617242 , 9160889 , 9872330 , (Europe PMC )0.96 BioGRID, IntAct, MINT FOSB Affinity Capture-MS, PCA, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , 29020630 , (Europe PMC )0.46 BioGRID, IntAct, MINT FOSL1 Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11431474 , 20511396 , 23661758 , 24029232 , 26258633 , 9160889 , (Europe PMC )0.67 BioGRID, IntAct FOSL2 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification, two hybrid array, two hybrid prey pooling approach association, direct interaction, physical, physical association 20102225 , 25609649 , 26186194 , 26496610 , 28514442 , 9160889 , (Europe PMC )0.81 BioGRID, IntAct, MINT GATA2 Reconstituted Complex physical 11278891 , (Europe PMC )NA BioGRID GOPC Affinity Capture-MS, Reconstituted Complex, display technology, tandem affinity purification association, physical, physical association 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT GSK3B Biochemical Activity, Co-localization, proximity ligation assay physical, physical association 17215518 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct GTF2B Reconstituted Complex physical 7848298 , (Europe PMC )NA BioGRID GTF2E2 Reconstituted Complex physical 8628277 , (Europe PMC )NA BioGRID GTF2F1 Reconstituted Complex physical 8628277 , (Europe PMC )NA BioGRID GTF2F2 Reconstituted Complex physical 8628277 , (Europe PMC )NA BioGRID HAUS6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HDAC1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 17056544 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HDAC3 Affinity Capture-Western physical 12853483 , (Europe PMC )NA BioGRID HDAC9 Reconstituted Complex physical 16611996 , (Europe PMC )NA BioGRID HDGF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HIF1A Affinity Capture-Western physical 11739718 , 19738058 , (Europe PMC )NA BioGRID HMGA1 Reconstituted Complex, Two-hybrid physical 10357819 , 10428834 , (Europe PMC )NA BioGRID HNRNPM Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 11823437 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HOXB9 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT HOXD13 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT HSP90AA1 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, display technology, two hybrid pooling approach association, physical, physical association 20195357 , 20936779 , 25609649 , (Europe PMC )0.68 BioGRID, IntAct, MINT HSPA8 Reconstituted Complex, anti bait coimmunoprecipitation, display technology association, physical, physical association 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT IARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT IKBKB Biochemical Activity physical 19656241 , (Europe PMC )NA BioGRID INPP5B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITCH Affinity Capture-Western, Reconstituted Complex physical 16901904 , 19806201 , 19818398 , (Europe PMC )NA BioGRID ITPK1 Biochemical Activity physical 12324474 , (Europe PMC )NA BioGRID JDP2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 18671972 , 25609649 , (Europe PMC )0.60 BioGRID, IntAct, MINT JUN PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 10488148 , 20102225 , 21675959 , 25609649 , 7848298 , 8440710 , (Europe PMC )0.64 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 25609649 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUND Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT KAT2B Affinity Capture-Western physical 18443043 , (Europe PMC )NA BioGRID KAT7 Affinity Capture-Western, Reconstituted Complex physical 16880509 , (Europe PMC )NA BioGRID KDM2B Affinity Capture-Western physical 17704768 , (Europe PMC )NA BioGRID KHSRP Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT KLF5 Reconstituted Complex physical 19628677 , (Europe PMC )NA BioGRID KMT2C Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct KPNA2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid association, physical, physical association 21988832 , 25609649 , (Europe PMC )0.63 BioGRID, IntAct, MINT LIG3 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT M6PR Protein-peptide physical 15044437 , (Europe PMC )NA BioGRID MACF1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MAP2K4 Biochemical Activity physical 13130464 , (Europe PMC )NA BioGRID MAP2K7 Biochemical Activity physical 13130464 , (Europe PMC )NA BioGRID MAP3K1 Biochemical Activity physical 12796506 , (Europe PMC )NA BioGRID MAPK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10419510 , 11431474 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MAPK10 Biochemical Activity, Reconstituted Complex, Two-hybrid, protein kinase assay, pull down, two hybrid direct interaction, phosphorylation reaction, physical, physical association 16007099 , 16824735 , 19527717 , 21988832 , 22327296 , 8654373 , 9596579 , (Europe PMC )0.76 BioGRID, IntAct, MINT MAPK14 Biochemical Activity physical 25483191 , (Europe PMC )NA BioGRID MAPK3 Biochemical Activity physical 1922387 , (Europe PMC )NA BioGRID MAPK8 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, in-gel kinase assay, protein kinase assay direct interaction, phosphorylation reaction, physical 10393177 , 10419510 , 10464310 , 10747973 , 10908726 , 10962563 , 10987838 , 11108663 , 11278395 , 11479302 , 11907583 , 12052834 , 12149229 , 12185592 , 12228228 , 12697749 , 12832416 , 12963725 , 13130464 , 14517282 , 14557262 , 14572659 , 14612408 , 14633987 , 14701799 , 15143066 , 15289320 , 15299005 , 15590691 , 15677475 , 15749833 , 15894542 , 15958389 , 16007099 , 16157600 , 16166642 , 16291755 , 16434970 , 16533805 , 16549498 , 16740711 , 16824735 , 16983342 , 17189706 , 17363973 , 17875713 , 18003900 , 18429822 , 18922473 , 18957422 , 19270716 , 19527717 , 19910486 , 20133937 , 20732415 , 22110360 , 22904686 , 23816567 , 25098452 , 8001819 , 8137421 , 8586671 , 8621542 , 8654373 , 8846788 , 9032244 , 9575168 , 9692890 , 9774977 , 9808624 , (Europe PMC )0.44, 0.85 BioGRID, IntAct, MINT MAPK8IP1 Affinity Capture-Western physical 16343492 , (Europe PMC )NA BioGRID MAPK9 Biochemical Activity, Reconstituted Complex, Two-hybrid, protein kinase assay phosphorylation reaction, physical 10490605 , 11278395 , 12788955 , 16533805 , 16824735 , 17189706 , 17875713 , 19527717 , 19910486 , 8001819 , 8654373 , 8945519 , 8985011 , 9596579 , (Europe PMC )0.44 BioGRID, IntAct, MINT MAPRE3 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct MAX Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID MAZ Affinity Capture-Western, Far Western, anti bait coimmunoprecipitation association, physical 19028685 , (Europe PMC )0.35 BioGRID, IntAct MBD3 Affinity Capture-Western, Reconstituted Complex physical 21196933 , (Europe PMC )NA BioGRID MDM2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct MEF2A Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT MEF2D Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MLLT6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTA1 Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, direct interaction, physical 21555589 , 25609649 , (Europe PMC )0.59 BioGRID, IntAct, MINT MTA3 Affinity Capture-Western physical 21196933 , (Europe PMC )NA BioGRID MTDH Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 25609649 , 27956703 , (Europe PMC )0.35 BioGRID, IntAct, MINT MUC1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 20697347 , (Europe PMC )0.40 BioGRID, IntAct MYC Affinity Capture-Western, tandem affinity purification association, physical 20232342 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct MYOD1 Affinity Capture-Western, Reconstituted Complex physical 1310896 , (Europe PMC )NA BioGRID NACA Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 25609649 , 9488446 , (Europe PMC )0.35 BioGRID, IntAct, MINT NAT14 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NBR1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT NCKIPSD Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NCOA1 Reconstituted Complex, Two-hybrid physical 10567404 , 10847592 , 9642216 , (Europe PMC )NA BioGRID NCOA6 Reconstituted Complex physical 10847592 , (Europe PMC )NA BioGRID NCOR1 Co-localization physical 17440114 , (Europe PMC )NA BioGRID NCOR2 Reconstituted Complex, Two-hybrid physical 10777532 , (Europe PMC )NA BioGRID NEDD4 Affinity Capture-Western, Two-hybrid physical 17538020 , (Europe PMC )NA BioGRID NELFB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 15530430 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NFAT5 Affinity Capture-Western physical 18056707 , (Europe PMC )NA BioGRID NFATC1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 25609649 , 27637333 , (Europe PMC )0.61 BioGRID, IntAct, MINT NFATC2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification association, direct interaction, physical, physical association 20557936 , 25609649 , 27637333 , (Europe PMC )0.35, 0.59 BioGRID, IntAct, MINT NFATC4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NFE2L1 Affinity Capture-Western, Reconstituted Complex physical 9872330 , (Europe PMC )NA BioGRID NFE2L2 Affinity Capture-Western, Reconstituted Complex physical 20194533 , 20232342 , 9872330 , (Europe PMC )NA BioGRID NFIX Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NFYA Affinity Capture-Western physical 11903046 , 21565167 , (Europe PMC )NA BioGRID NKRF Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT NKX2-5 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NR2F6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NR3C1 Reconstituted Complex physical 14522952 , (Europe PMC )NA BioGRID NR5A1 Reconstituted Complex, anti tag coimmunoprecipitation association, physical 10478848 , 24635384 , (Europe PMC )0.35 BioGRID, IntAct NRIP1 Reconstituted Complex physical 12554755 , (Europe PMC )NA BioGRID OIP5 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID PARP1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 24636898 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PDS5A Affinity Capture-MS physical 25609649 , (Europe PMC )NA BioGRID PHF21A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PHLDB3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PHOX2A Reconstituted Complex physical 14506227 , (Europe PMC )NA BioGRID PIAS1 Biochemical Activity, Reconstituted Complex physical 11867732 , (Europe PMC )NA BioGRID PIAS2 Biochemical Activity, Reconstituted Complex physical 11867732 , (Europe PMC )NA BioGRID PIN1 Affinity Capture-Western, Reconstituted Complex physical 11432833 , (Europe PMC )NA BioGRID PML Affinity Capture-Western, Co-localization, Reconstituted Complex physical 10620019 , 15626733 , 16916642 , 9671405 , (Europe PMC )NA BioGRID POU1F1 Reconstituted Complex physical 8663380 , (Europe PMC )NA BioGRID PPARG Protein-peptide physical 11877444 , (Europe PMC )NA BioGRID PPP2R2D Affinity Capture-MS physical 19156129 , 28514442 , (Europe PMC )NA BioGRID PPP3CA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 17215518 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PPP3CB FRET, Reconstituted Complex physical 17952113 , (Europe PMC )NA BioGRID PPP4C Reconstituted Complex physical 9837938 , (Europe PMC )NA BioGRID PRKD1 Biochemical Activity physical 11948398 , 12628923 , (Europe PMC )NA BioGRID PRKDC Biochemical Activity, anti bait coimmunoprecipitation association, physical 25609649 , 8464713 , (Europe PMC )0.35 BioGRID, IntAct, MINT PRRC2A Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct RACK1 Affinity Capture-Western physical 21860413 , (Europe PMC )NA BioGRID RALBP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RANGAP1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10026157 , 9545246 , (Europe PMC )NA BioGRID RBM39 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 11704680 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT RELA Phenotypic Enhancement, Two-hybrid genetic, physical 10488148 , (Europe PMC )NA BioGRID RNF187 Affinity Capture-Western, Reconstituted Complex physical 20852630 , 23624934 , (Europe PMC )NA BioGRID RPRD1A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RPS6KA2 Biochemical Activity physical 7623830 , (Europe PMC )NA BioGRID RUNX1 Affinity Capture-Western, Reconstituted Complex physical 11274169 , 11641401 , (Europe PMC )NA BioGRID RUNX2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11274169 , 11641401 , (Europe PMC )NA BioGRID SATB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SATB2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SIRT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 18823944 , 20042607 , 23382074 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SIX4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SKI Affinity Capture-Western physical 12034730 , (Europe PMC )NA BioGRID SMAD2 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, display technology association, physical, physical association 11371641 , 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT SMAD3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10220381 , 10903323 , 11306568 , 21829441 , 9732876 , (Europe PMC )NA BioGRID SMAD4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SMARCB1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SMARCC1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SMARCC2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SMARCD3 Reconstituted Complex physical 14701856 , (Europe PMC )NA BioGRID SMARCE1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SP1 Affinity Capture-Western, Reconstituted Complex physical 10506225 , 16478997 , 17215518 , (Europe PMC )NA BioGRID SPI1 Reconstituted Complex physical 9681824 , (Europe PMC )NA BioGRID SPIB Reconstituted Complex physical 10196196 , (Europe PMC )NA BioGRID STAT1 Affinity Capture-Western physical 10490649 , (Europe PMC )NA BioGRID STAT3 Affinity Capture-Western, Reconstituted Complex physical 10490649 , (Europe PMC )NA BioGRID STAT4 Affinity Capture-Western physical 11801649 , (Europe PMC )NA BioGRID STAT6 Affinity Capture-Western physical 21357535 , (Europe PMC )NA BioGRID STRN4 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct SUMO1 PCA physical 15469925 , (Europe PMC )NA BioGRID TAF1 Reconstituted Complex physical 11316804 , (Europe PMC )NA BioGRID TAF4 Reconstituted Complex, pull down association, physical 20557936 , (Europe PMC )0.35 BioGRID, IntAct TBP Reconstituted Complex physical 7848298 , (Europe PMC )NA BioGRID TCF20 Reconstituted Complex physical 8663478 , (Europe PMC )NA BioGRID TCL1A Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 19064921 , (Europe PMC )0.52 BioGRID, IntAct TFAP2A Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT TGIF1 Affinity Capture-Western, Reconstituted Complex physical 11371641 , (Europe PMC )NA BioGRID TMED1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT TOP2A Far Western, anti bait coimmunoprecipitation association, physical 25609649 , 8387155 , (Europe PMC )0.35 BioGRID, IntAct, MINT TPM3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRAF2 Biochemical Activity physical 12796506 , (Europe PMC )NA BioGRID TRIM33 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT TRIP4 Reconstituted Complex, Two-hybrid physical 12077347 , (Europe PMC )NA BioGRID TSC22D3 Reconstituted Complex physical 11397794 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-Western, Two-hybrid physical 17538020 , (Europe PMC )NA BioGRID UBC PCA, Two-hybrid, pull down, two hybrid pooling approach association, physical, physical association 15469925 , 19343052 , 20936779 , (Europe PMC )0.55 BioGRID, IntAct, MINT UBE2I Biochemical Activity, Two-hybrid physical 10788439 , 8733011 , (Europe PMC )NA BioGRID UBXN7 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID USP6 Affinity Capture-Western, Biochemical Activity physical 29061731 , (Europe PMC )NA BioGRID VARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT VAV1 Biochemical Activity physical 11287617 , (Europe PMC )NA BioGRID VDR Reconstituted Complex physical 10330159 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-MS physical 25796446 , (Europe PMC )NA BioGRID ZBTB7C Affinity Capture-Western, Reconstituted Complex physical 27646874 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AATF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACAD11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACADM anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACLY anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACSL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTL6A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTR1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADAR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADNP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADRM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADSL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AFDN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AFG3L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AGAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AHCY anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AHCYL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AHSA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AIFM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AIM2 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct AIMP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AIMP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AK2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH18A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH1B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH5A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH7A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDOA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALKBH5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALPI anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALYREF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AMOT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANAPC10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKHD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKRD17 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKRD26 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKRD42 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANP32A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANP32B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANXA11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANXA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP1B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2M1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2S1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP3B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP3M1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT APEX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT APLP2 Reconstituted Complex, Two-hybrid, display technology, two hybrid pooling approach physical, physical association 20195357 , 20936779 , (Europe PMC )0.57 BioGRID, IntAct APOA2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT APOD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT APP Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct ARCN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARGLU1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARHGDIA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARID1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARID3B Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT ARIH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARNTL Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ARPC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARRB1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct ARSJ anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASB7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASCL4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASNS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASPDH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATAD3A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATAD3B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATF1 anti bait coimmunoprecipitation, pull down association, physical association 25609649 , (Europe PMC )0.50 IntAct, MINT ATF2 Affinity Capture-MS, Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, display technology, peptide array, proximity ligation assay, tandem affinity purification association, direct interaction, physical, physical association 10207054 , 10327051 , 15546613 , 1827203 , 20102225 , 20195357 , 20511396 , 2320002 , 23661758 , 25609649 , 26496610 , 28514442 , 8027667 , (Europe PMC )0.87 BioGRID, IntAct, MINT ATF3 Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical, physical association 10327051 , 14667575 , 1827203 , 20102225 , 20304822 , 23661758 , 25609649 , 26496610 , 8622660 , (Europe PMC )0.73 BioGRID, IntAct, MINT ATF4 Co-localization, FRET, Reconstituted Complex, Two-hybrid, proximity ligation assay, two hybrid pooling approach physical, physical association 1827203 , 20936779 , 23661758 , 25241761 , (Europe PMC )0.57 BioGRID, IntAct ATF7 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26496610 , (Europe PMC )0.35, 0.64 BioGRID, IntAct, MINT ATP1A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP2A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP2A2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5O anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1B2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1E1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1G1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATXN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AURKA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AURKB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BANP Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BARD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BATF FRET, peptide array direct interaction, physical 20102225 , 23661758 , (Europe PMC )0.44 BioGRID, IntAct BATF2 FRET, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical, physical association 19074269 , 23661758 , (Europe PMC )0.58 BioGRID, IntAct BATF3 Affinity Capture-MS, FRET, Reconstituted Complex, peptide array, tandem affinity purification association, direct interaction, physical 10878360 , 20102225 , 23661758 , 25609649 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct, MINT BBS7 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct BCAS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BEND4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BLMH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BPIFA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRCA1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12080089 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BRD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRD4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRIX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BTAF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BUB3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BUD31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BYSL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C11orf98 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C18orf25 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C18orf63 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C1QBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C1orf131 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C7orf50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CACYBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CALD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CALR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAMK2D anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAND1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CANX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAPRIN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAPZA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAPZB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBFB display technology physical association 20195357 , (Europe PMC )0.40 IntAct CBR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBX3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBX5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBX8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CC2D1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCAR2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCDC47 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCDC93 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CCNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT6A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC37 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC42 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC5L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC73 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDK11A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDK12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CEBPB tandem affinity purification association 25609649 , (Europe PMC )0.35 IntAct, MINT CENPF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CFAP20 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CFL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CGGBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHAF1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHAF1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHAMP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHCHD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHD3 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 21196933 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT CHD4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHEK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHL1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct CHTOP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CIRBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CITED1 coimmunoprecipitation, pull down physical association 10327051 , (Europe PMC )0.52 IntAct, MINT CKAP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKAP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKAP5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKMT1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CLIC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CLTC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CMAS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CMSS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CNOT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COG6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPB2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS2 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 16045761 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT COPS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS5 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 10766246 , 20093369 , 25609649 , 8837781 , (Europe PMC )0.35 BioGRID, IntAct, MINT COPS6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS7A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CORO1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPNE2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPOX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CREB1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, tandem affinity purification association, physical 2138276 , 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT CREB3 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct CREB5 Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 25609649 , 26186194 , 26496610 , 28514442 , 8440710 , (Europe PMC )0.35, 0.46 BioGRID, IntAct, MINT CRKL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CRLF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CRNKL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSDE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSE1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1A1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1D anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1E anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK2A1 Biochemical Activity, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12628923 , 25609649 , 9685505 , (Europe PMC )0.35 BioGRID, IntAct, MINT CSNK2A2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK2B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSRP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSTB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CTBP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CTNNA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CTNNBL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CUL4A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CUL5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CUX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CWC15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CWF19L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CXorf56 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CYC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DAB2 in-gel kinase assay phosphorylation reaction 15894542 , (Europe PMC )0.44 IntAct DACH1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation association, physical 16980615 , 17182846 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT DAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT DAZAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DBN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DBT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCAF13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCAF6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCAF7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCTN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCTN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCXR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDOST anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDRGK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX17 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX20 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX21 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, experimental interaction detection, pull down association, direct interaction, physical, physical association 11823437 , 25609649 , (Europe PMC )0.67 BioGRID, IntAct, MINT DDX23 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX24 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX27 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX39A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX3X anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX41 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX46 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX47 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX49 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX52 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX54 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX56 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DEK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DEPDC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DES anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHRS7B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX16 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX29 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX30 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX36 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX37 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DIMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DIRAS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DIS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DKC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLAT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLGAP5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLST anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DMAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJA3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJB4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJC13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJC7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJC9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DPF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DPM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DRG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DSG2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DSTN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DUS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DYNC1H1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DYNC1I2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DYNC2H1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EBF3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT EBI-10026580 electrophoretic mobility supershift assay physical association 20976523 , (Europe PMC )0.40 IntAct EBI-10041770 electrophoretic mobility shift assay, electrophoretic mobility supershift assay association, direct interaction 19028685 , (Europe PMC )0.58 IntAct EBI-10041773 electrophoretic mobility shift assay, electrophoretic mobility supershift assay association 19028685 , (Europe PMC )0.46 IntAct EBI-10042615 electrophoretic mobility supershift assay association, physical association 24646654 , (Europe PMC )0.50 IntAct EBI-10043688 electrophoretic mobility supershift assay physical association 23339184 , (Europe PMC )0.40 IntAct EBI-10043825 pull down physical association 22546605 , (Europe PMC )0.40 IntAct EBI-10045484 electrophoretic mobility supershift assay physical association 25260594 , (Europe PMC )0.40 IntAct EBI-10045487 electrophoretic mobility supershift assay physical association 25260594 , (Europe PMC )0.40 IntAct EBI-10096068 electrophoretic mobility supershift assay physical association 12788789 , (Europe PMC )0.40 IntAct EBI-10096074 electrophoretic mobility supershift assay physical association 12788789 , (Europe PMC )0.40 IntAct EBI-10099221 electrophoretic mobility supershift assay physical association 19487245 , (Europe PMC )0.40 IntAct EBI-10106674 electrophoretic mobility supershift assay physical association 19064995 , (Europe PMC )0.40 IntAct EBI-10918391 electrophoretic mobility shift assay direct interaction 23642711 , (Europe PMC )0.44 IntAct EBI-11323206 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EBI-4399559 anti bait coimmunoprecipitation physical association 17592138 , (Europe PMC )0.40 IntAct EBNA1BP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ECH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EDF1 Affinity Capture-Western, Reconstituted Complex, pull down physical, physical association 10567391 , 16880509 , (Europe PMC )0.40 BioGRID, IntAct EEF1A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF1B2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF1D Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT EEF1E1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF1G anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EFTUD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EGLN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EIF2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2AK2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S3L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3D anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3E anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3F anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3M anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF4A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF4A3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF4G1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF5A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF5B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF6 {ECO:0000255|HAMAP-Rule:MF_03132, anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ELAVL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ELOB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ELP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EMG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ENO1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ENSG00000006210 chromatin immunoprecipitation assay association 25040843 , (Europe PMC )0.35 IntAct ENSG00000012048 chromatin immunoprecipitation assay association 23339184 , (Europe PMC )0.35 IntAct ENSG00000054598 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000100985 chromatin immunoprecipitation assay association 22348975 , 25040843 , (Europe PMC )0.53 IntAct ENSG00000109471 chromatin immunoprecipitation assay association 20557936 , (Europe PMC )0.35 IntAct ENSG00000116711 chromatin immunoprecipitation assay association 24069158 , (Europe PMC )0.35 IntAct ENSG00000136997 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000160182 chromatin immunoprecipitation assay association 19487245 , 25303530 , (Europe PMC )0.53 IntAct ENSG00000163453 chromatin immunoprecipitation assay association 18267069 , (Europe PMC )0.35 IntAct ENSG00000165376 chromatin immunoprecipitation assay association 22546605 , (Europe PMC )0.35 IntAct ENSG00000167323 chromatin immunoprecipitation assay association 25016017 , (Europe PMC )0.35 IntAct ENSG00000169429 chromatin immunoprecipitation assay association 19064995 , (Europe PMC )0.35 IntAct ENSG00000181634 chromatin immunoprecipitation assay association 23642711 , (Europe PMC )0.35 IntAct ENSG00000196208 chromatin immunoprecipitation assay association 25303530 , (Europe PMC )0.35 IntAct ENSG00000196611 chromatin immunoprecipitation assay association 25260594 , (Europe PMC )0.35 IntAct ENSG00000196620 chromatin immunoprecipitation assay association 19487245 , (Europe PMC )0.35 IntAct ENSG00000199065 chromatin immunoprecipitation assay association 25260594 , (Europe PMC )0.35 IntAct ENSG00000255346 chromatin immunoprecipitation assay association 22348975 , (Europe PMC )0.35 IntAct EP300 Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10327051 , 11689449 , 11980644 , 12437352 , 12471036 , 14630807 , 21268080 , 21937452 , 24069158 , 24636898 , 27956703 , (Europe PMC )0.35 BioGRID, IntAct EPB41L3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EPB41L5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EPHB4 display technology physical association 20195357 , (Europe PMC )0.40 IntAct EPRS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ERI3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ERLIN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ERLIN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ETF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ETFA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ETS1 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , 8557686 , (Europe PMC )0.52 BioGRID, IntAct EWSR1 Proximity Label-MS, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14550555 , 24999758 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT EXD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EZR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAHD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAM98A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAM98B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FARSA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FARSB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FASN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAU anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FBL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FBXO11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FBXO22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FEN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHOD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FIGNL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FIP1L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FKBP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FKBP8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FLII anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FLNA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FLNC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FMR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FNBP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FOS Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Co-localization, FRET, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, circular dichroism, display technology, fluorescent resonance energy transfer, isothermal titration calorimetry, peptide array, proximity ligation assay, tandem affinity purification, two hybrid, two hybrid pooling approach, x-ray crystallography association, direct interaction, physical, physical association 10488148 , 11053448 , 11090181 , 11431474 , 15319445 , 15718494 , 15994313 , 16008525 , 16055710 , 16714286 , 16928824 , 17440114 , 18172215 , 18848838 , 20102225 , 20195357 , 20410304 , 20498278 , 20511396 , 20936779 , 21199371 , 21675959 , 22719067 , 23602568 , 23661758 , 24029232 , 25609649 , 26186194 , 26496610 , 28514442 , 7816143 , 8380166 , 8440710 , 8617242 , 9160889 , 9872330 , (Europe PMC )0.96 BioGRID, IntAct, MINT FOSB Affinity Capture-MS, PCA, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , 29020630 , (Europe PMC )0.46 BioGRID, IntAct, MINT FOSL1 Affinity Capture-Western, FRET, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay association, physical, physical association 11431474 , 20511396 , 23661758 , 24029232 , 26258633 , 9160889 , (Europe PMC )0.67 BioGRID, IntAct FOSL2 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification, two hybrid array, two hybrid prey pooling approach association, direct interaction, physical, physical association 20102225 , 25609649 , 26186194 , 26496610 , 28514442 , 9160889 , (Europe PMC )0.81 BioGRID, IntAct, MINT FOXRED1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FRG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FTSJ3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FUS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FXR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FXR2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT G3BP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT G3BP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GABARAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GABARAPL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GAD1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct GAPDH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GART anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GATAD2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GCN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GDI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GDI2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GEMIN4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GEMIN5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GFM2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GFPT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GLDC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GLUD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GMPS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNAI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNB1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GOLGA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GOPC Affinity Capture-MS, Reconstituted Complex, display technology, tandem affinity purification association, physical, physical association 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT GOT2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPATCH11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPI anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPX4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GRPEL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GRWD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GSK3B Biochemical Activity, Co-localization, proximity ligation assay physical, physical association 17215518 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct GSR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GSTP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTF2I anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTF3C1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTF3C5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTPBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTPBP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTSE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GYS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GYS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H1F0 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H1FX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H2AFV anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H2AFY anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H2AFY2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HACD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HADHA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HADHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HAT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HAUS6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HCFC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HDAC1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 17056544 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HDAC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HDGF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HDLBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HEATR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HEATR3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HERC1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct HERC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2AA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2AB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2AD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2BA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2BB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2BC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H4A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST2H2BC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST3H3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HMMR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA0 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA1L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA2B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPAB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPCL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPDL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPH3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPM Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 11823437 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HNRNPR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPU anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPUL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPUL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HOOK2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct HOXB9 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT HOXC13 tandem affinity purification association 25609649 , (Europe PMC )0.35 IntAct, MINT HOXD13 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT HP1BP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HPRT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HRAS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSD17B10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSD17B11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSD17B4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSDL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AA1 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, display technology, two hybrid pooling approach association, physical, physical association 20195357 , 20936779 , 25609649 , (Europe PMC )0.68 BioGRID, IntAct, MINT HSP90AA2P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AA5P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AB2P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AB3P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA4L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA8 Reconstituted Complex, anti bait coimmunoprecipitation, display technology association, physical, physical association 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT HSPA9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HYOU1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT IBA57 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IDE anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IDH3B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGF2BP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGF2BP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGF2BP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGHA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGLL5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IKBIP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ILF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ILF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ILKAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IMMT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IMP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IMPDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT INA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT INCENP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT INPP5B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IPO8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IPO9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IQGAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IRS4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ISG20L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ISOC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT JDP2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 18671972 , 25609649 , (Europe PMC )0.60 BioGRID, IntAct, MINT JUN PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 10488148 , 20102225 , 21675959 , 25609649 , 7848298 , 8440710 , (Europe PMC )0.64 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 25609649 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUND Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT KARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KDM1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KHDRBS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KHSRP Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT KIF2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIF5A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIF5B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIFAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIFC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KMT2C Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct KPNA2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid association, physical, physical association 21988832 , 25609649 , (Europe PMC )0.63 BioGRID, IntAct, MINT KPNA4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KPNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KRI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KRR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KTN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LANCL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP4B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LBR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LCP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LDHA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LDHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LETM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LETMD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LIG3 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT LMNA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LMNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LMNB2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LONP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRP5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRPPRC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRRC40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRRC47 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRRC59 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LSG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LSM12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LYAR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LYZ anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MACF1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct MAFF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAGED2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAGT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP1LC3A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP4K2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP4K4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP7D1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP7D2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAPK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10419510 , 11431474 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MAPK10 Biochemical Activity, Reconstituted Complex, Two-hybrid, protein kinase assay, pull down, two hybrid direct interaction, phosphorylation reaction, physical, physical association 16007099 , 16824735 , 19527717 , 21988832 , 22327296 , 8654373 , 9596579 , (Europe PMC )0.76 BioGRID, IntAct, MINT MAPK8 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, in-gel kinase assay, protein kinase assay direct interaction, phosphorylation reaction, physical 10393177 , 10419510 , 10464310 , 10747973 , 10908726 , 10962563 , 10987838 , 11108663 , 11278395 , 11479302 , 11907583 , 12052834 , 12149229 , 12185592 , 12228228 , 12697749 , 12832416 , 12963725 , 13130464 , 14517282 , 14557262 , 14572659 , 14612408 , 14633987 , 14701799 , 15143066 , 15289320 , 15299005 , 15590691 , 15677475 , 15749833 , 15894542 , 15958389 , 16007099 , 16157600 , 16166642 , 16291755 , 16434970 , 16533805 , 16549498 , 16740711 , 16824735 , 16983342 , 17189706 , 17363973 , 17875713 , 18003900 , 18429822 , 18922473 , 18957422 , 19270716 , 19527717 , 19910486 , 20133937 , 20732415 , 22110360 , 22904686 , 23816567 , 25098452 , 8001819 , 8137421 , 8586671 , 8621542 , 8654373 , 8846788 , 9032244 , 9575168 , 9692890 , 9774977 , 9808624 , (Europe PMC )0.44, 0.85 BioGRID, IntAct, MINT MAPK9 Biochemical Activity, Reconstituted Complex, Two-hybrid, protein kinase assay phosphorylation reaction, physical 10490605 , 11278395 , 12788955 , 16533805 , 16824735 , 17189706 , 17875713 , 19527717 , 19910486 , 8001819 , 8654373 , 8945519 , 8985011 , 9596579 , (Europe PMC )0.44 BioGRID, IntAct, MINT MAPRE3 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct MARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MATR3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAZ Affinity Capture-Western, Far Western, anti bait coimmunoprecipitation association, physical 19028685 , (Europe PMC )0.35 BioGRID, IntAct MB21D2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCCC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCTS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MDC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MDH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MDM2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct MECOM anti bait coimmunoprecipitation association 22308434 , (Europe PMC )0.35 IntAct MECP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MEF2A Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT MEF2C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MEF2D Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MFAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MGST2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MICU2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MKI67 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MMTAG2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MOGS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MOV10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MPG anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MPP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRE11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL19 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL32 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL37 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL38 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL39 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL46 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL58 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS18A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS18B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS26 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS27 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS33 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS34 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS35 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MSH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MSI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MT-CO2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTA1 Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, direct interaction, physical 21555589 , 25609649 , (Europe PMC )0.59 BioGRID, IntAct, MINT MTA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTDH Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 25609649 , 27956703 , (Europe PMC )0.35 BioGRID, IntAct, MINT MTHFD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTHFD1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTHFR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTPAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTREX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MUC1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 20697347 , (Europe PMC )0.40 BioGRID, IntAct MYBBP1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYC Affinity Capture-Western, tandem affinity purification association, physical 20232342 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct MYH10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYH11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYH14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYH9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYL12A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYL6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYL6B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYLK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYO1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYO6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAA50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NACA Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 25609649 , 9488446 , (Europe PMC )0.35 BioGRID, IntAct, MINT NAP1L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAP1L4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAT10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAT14 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NBR1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT NCBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NCL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFA6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFA9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFS8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFV2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NEFM anti bait coimmunoprecipitation, display technology association, physical association 20195357 , 25609649 , (Europe PMC )0.56 IntAct, MINT NELFB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 15530430 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NEMF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NFATC1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 25609649 , 27637333 , (Europe PMC )0.61 BioGRID, IntAct, MINT NFATC2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification association, direct interaction, physical, physical association 20557936 , 25609649 , 27637333 , (Europe PMC )0.35, 0.59 BioGRID, IntAct, MINT NFATC3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NFATC4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NFIA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NFIX Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NIFK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NIPSNAP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NKRF Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT NKX2-5 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NLE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NMD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOC2L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOC3L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOC4L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOL11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOL6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOLC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOMO1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NONO anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP56 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP58 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOSIP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NPEPPS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NPM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NPM3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NR2F6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NR5A1 Reconstituted Complex, anti tag coimmunoprecipitation association, physical 10478848 , 24635384 , (Europe PMC )0.35 BioGRID, IntAct NRDC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NSUN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NSUN5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDT16 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDT16L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDT21 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUP155 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUSAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NXF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT OAT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT OLA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ORC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT P4HB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PA2G4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PABPC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PABPC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PABPN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PAICS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PARP1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 24636898 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PARS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PAXBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PBDC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCBP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCMTD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCMTD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCNA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDCD11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDHX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDIA3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDIA6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDK3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDS5A anti bait coimmunoprecipitation, tandem affinity purification association 25609649 , (Europe PMC )0.46 IntAct, MINT PELO anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PES1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PFN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PGAM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PGAM5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PGK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PHAX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PHB2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PHF21A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PHF6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PHGDH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PHLDB3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PIP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PIP4K2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PKM anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PLK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PLRG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PLS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PMPCB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POLDIP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POLDIP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POLR1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POLR2C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POLR2E anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POLRMT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POP7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT POTEKP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPAN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPIA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPIAL4A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPIB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPM1G anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP1CA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP1CB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP1CC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP1R12A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP1R12C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP2CA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP2R1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP2R2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PPP2R2B anti tag coimmunoprecipitation, pull down association 19156129 , (Europe PMC )0.46 IntAct PPP3CA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 17215518 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PRDX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRDX2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRDX3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRDX4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRDX6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRIM2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRKAR2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRKCSH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRKDC Biochemical Activity, anti bait coimmunoprecipitation association, physical 25609649 , 8464713 , (Europe PMC )0.35 BioGRID, IntAct, MINT PRMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRMT3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRMT5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPF19 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPF31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPF4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPF40A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPF6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPF8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPSAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRPSAP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRRC2A Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct PRRC2B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PRSS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSIP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMA4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMA6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMA7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMB3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMB4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMB5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMB6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMC3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMC6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSMD8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSME4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PSPC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PTBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PTBP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PTCD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PTMA display technology physical association 20195357 , (Europe PMC )0.40 IntAct PTPN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PUF60 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PUM3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PURA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PWP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PWP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PYCR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PYM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT QARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAB10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAB11FIP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAB1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAB33B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RACK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAD18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAD50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RALY anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RAN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RANBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RANBP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RANBP9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RANGAP1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT RARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBBP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBBP6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBBP7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM17 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM25 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM27 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM28 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM34 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM39 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 11704680 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT RBM4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBM4B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBMX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RBMXL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RCC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RCC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RCL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RCOR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RECQL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RFC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RFC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RFC3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RFC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RFC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RFWD2 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, tandem affinity purification association, physical association 12615916 , 25117710 , 25609649 , (Europe PMC )0.35, 0.62 IntAct, MINT RGPD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RIF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RING1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RNGTT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RNH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RNMT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RNPS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RORC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL10A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL10L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL13A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL17 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL18A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL19 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL21 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL23 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL23A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL24 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL26 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL26L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL27 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL27A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL28 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL29 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL30 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL34 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL35 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL35A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL36 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL36A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL37A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL38 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL7A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL7L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPL9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPLP0 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPLP0P6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPLP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPLP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPP30 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPRD1A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct RPRD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS10P5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS15A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS16 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS17 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS19 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS20 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS23 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS24 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS25 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS26 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS26P11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS27L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS28 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS29 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS3A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS4X anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS6KB2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPS9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPSA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RPUSD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RRBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RRP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RRP12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RRP15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RRP1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RRP7A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RRS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RSL1D1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RTCA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RTCB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RTRAF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RUVBL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT RUVBL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SAFB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SAR1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SARS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SART1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SART3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SATB1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SATB2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SCAF8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SCFD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SDHA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SDHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SEC23A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SEC24C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SEMG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SEPT2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SERBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SERPINH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SET anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3A2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3A3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3B2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3B3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3B4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SF3B6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SFPQ anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SFSWAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SFXN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SGPL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SH3D21 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SHMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SHMT2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SIRT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 18823944 , 20042607 , 23382074 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SIX4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SLC1A5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A19 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC25A6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC32A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC33A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC3A2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC4A1AP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SLC4A8 {ECO:0000312|EMBL:AAY79176.1, display technology physical association 20195357 , (Europe PMC )0.40 IntAct SMAD2 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, display technology association, physical, physical association 11371641 , 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT SMAD4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT SMAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMARCA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMARCA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMARCA4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMARCB1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SMARCC1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SMARCC2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SMARCD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMARCD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMARCE1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT SMC1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMC3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMCHD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SMU1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNAP91 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SND1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRNP200 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRNP40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRNP70 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRPA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRPB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRPB2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRPD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRPD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRPD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNRPE anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNW1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SNX6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SPATA5L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SPECC1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SPOUT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SPTAN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SPTLC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRBD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRCAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRP14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRP68 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRP72 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRPK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRPK2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRPRA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRPRB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRRT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SRSF9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SS18 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SSB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SSBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SSR3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SSR4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SSRP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ST13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STAU1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STIM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STIP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STK40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STOML2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STON2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STRAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT STRN4 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct SUPT16H anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SYMPK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SYNCRIP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SYNE2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TAF4 Reconstituted Complex, pull down association, physical 20557936 , (Europe PMC )0.35 BioGRID, IntAct TALDO1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TARDBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TARS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TARSL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TBC1D4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TBL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TBL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TBR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TCERG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TCL1A Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 19064921 , (Europe PMC )0.52 BioGRID, IntAct TCOF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TCP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TEAD1 anti tag coimmunoprecipitation association 26258633 , (Europe PMC )0.35 IntAct TERF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TERF2IP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TES anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TEX10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TFAM anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TFAP2A Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT TFB1M anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TFCP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TFIP11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TFRC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT THOC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT THOC6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT THYN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TIMM23B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TIMM50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TIMP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TKT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TMCO1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TMED1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT TMED10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TMEM109 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TMEM214 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TMLHE anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TMPO anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TNK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TOMM20 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TOMM22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TOP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TOP2A Far Western, anti bait coimmunoprecipitation association, physical 25609649 , 8387155 , (Europe PMC )0.35 BioGRID, IntAct, MINT TOP2B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TP53 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TPM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TPR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TPX2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRA2B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRIM25 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRIM28 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRIM33 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT TRIP12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRIR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRMT1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRMT2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRMT6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TRMT61A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TROVE2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TSR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TTF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBA1A anti bait coimmunoprecipitation, display technology association, physical association 20195357 , 25609649 , (Europe PMC )0.56 IntAct, MINT TUBA1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBA4A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBB anti bait coimmunoprecipitation, display technology association, physical association 20195357 , 25609649 , (Europe PMC )0.56 IntAct, MINT TUBB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBB2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBB2B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBB3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBB4A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBB4B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBB6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUBGCP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TUFM anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT TXNDC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT U2AF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT U2SURP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UBA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UBA52 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UBAP2L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UBC PCA, Two-hybrid, pull down, two hybrid pooling approach association, physical, physical association 15469925 , 19343052 , 20936779 , (Europe PMC )0.55 BioGRID, IntAct, MINT UBE2L3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UBE2M anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UBE2O anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UBE2R2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UFL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UFM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UHRF1BP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UMPS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UPF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UPF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UPF3B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UQCRC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UQCRFS1P1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT USP10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT USP11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT USP39 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT USP7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT USP9X display technology physical association 20195357 , (Europe PMC )0.40 IntAct UTP14A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UTP15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT UTP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VAPA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VAPB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT VASP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VCP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VDAC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VDAC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VIM anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VIRMA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VN1R5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VPS35 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VRK1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, protein kinase assay association, colocalization, phosphorylation reaction, physical association 15378002 , 25609649 , (Europe PMC )0.67 IntAct, MINT VRK3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT VTN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WBP11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR36 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR43 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR45B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR46 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR82 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WDR83 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT WTAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT XM_932810.2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct XPNPEP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT XPO1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT XPOT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT XRCC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT XRCC6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT XRN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT XRN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YARS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YBX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YBX3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YME1L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YTHDC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YTHDF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YTHDF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YWHAB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YWHAE anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YWHAQ anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT YWHAZ anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZC3H11A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZC3H15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZC3H7B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZC3HAV1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZC3HAV1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZFR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZNF207 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZNF326 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZNF592 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZNF638 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZNF687 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZNF768 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ZYX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AATF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ABCF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACAD11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACADM anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACLY anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACSL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTL6A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ACTR1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADAR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADNP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADRM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ADSL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AFDN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AFG3L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AGAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AHCY anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AHCYL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AHSA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AIFM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AIMP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AIMP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AK2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH18A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH1B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH5A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDH7A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALDOA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALKBH5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALPI anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ALYREF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AMOT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANAPC10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKHD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKRD17 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKRD26 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANKRD42 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANP32A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANP32B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANXA11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ANXA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP1B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2M1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP2S1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP3B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AP3M1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT APEX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT APOA2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT APOD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARCN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARGLU1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARHGDIA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARID1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARID3B Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT ARIH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARPC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ARSJ anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASB7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASCL4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASNS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ASPDH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATAD3A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATAD3B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATF1 anti bait coimmunoprecipitation, pull down association, physical association 25609649 , (Europe PMC )0.50 IntAct, MINT ATF2 Affinity Capture-MS, Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, display technology, peptide array, proximity ligation assay, tandem affinity purification association, direct interaction, physical, physical association 10207054 , 10327051 , 15546613 , 1827203 , 20102225 , 20195357 , 20511396 , 2320002 , 23661758 , 25609649 , 26496610 , 28514442 , 8027667 , (Europe PMC )0.87 BioGRID, IntAct, MINT ATF3 Affinity Capture-MS, Affinity Capture-Western, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical, physical association 10327051 , 14667575 , 1827203 , 20102225 , 20304822 , 23661758 , 25609649 , 26496610 , 8622660 , (Europe PMC )0.73 BioGRID, IntAct, MINT ATF7 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26496610 , (Europe PMC )0.35, 0.64 BioGRID, IntAct, MINT ATP1A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP2A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP2A2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5F1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP5O anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1B2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1E1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATP6V1G1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ATXN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AURKA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT AURKB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BANP Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BARD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BATF3 Affinity Capture-MS, FRET, Reconstituted Complex, peptide array, tandem affinity purification association, direct interaction, physical 10878360 , 20102225 , 23661758 , 25609649 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct, MINT BCAS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BEND4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BLMH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BPIFA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRCA1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12080089 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT BRD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRD4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BRIX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BTAF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BUB3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BUD31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT BYSL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C11orf98 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C18orf25 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C18orf63 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C1QBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C1orf131 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT C7orf50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CACYBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CALD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CALR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAMK2D anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAND1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CANX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAPRIN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAPZA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CAPZB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBX3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBX5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CBX8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CC2D1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCAR2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCDC47 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT6A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CCT8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC37 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC42 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC5L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDC73 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDK11A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CDK12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CEBPB tandem affinity purification association 25609649 , (Europe PMC )0.35 IntAct, MINT CENPF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CFAP20 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CFL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CGGBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHAF1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHAF1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHAMP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHCHD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHD3 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 21196933 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT CHD4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHEK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CHTOP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CIRBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CITED1 coimmunoprecipitation, pull down physical association 10327051 , (Europe PMC )0.52 IntAct, MINT CKAP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKAP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKAP5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CKMT1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CLIC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CLTC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CMAS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CMSS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CNOT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COG6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPB2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS2 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 16045761 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT COPS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS5 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 10766246 , 20093369 , 25609649 , 8837781 , (Europe PMC )0.35 BioGRID, IntAct, MINT COPS6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT COPS7A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CORO1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPNE2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPOX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CPSF7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CREB1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, tandem affinity purification association, physical 2138276 , 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT CREB5 Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 25609649 , 26186194 , 26496610 , 28514442 , 8440710 , (Europe PMC )0.35, 0.46 BioGRID, IntAct, MINT CRKL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CRLF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CRNKL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSDE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSE1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1A1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1D anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK1E anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK2A1 Biochemical Activity, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 12628923 , 25609649 , 9685505 , (Europe PMC )0.35 BioGRID, IntAct, MINT CSNK2A2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSNK2B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSRP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CSTB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CTBP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CTNNA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CTNNBL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CUL4A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CUL5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CUX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CWC15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CWF19L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CXorf56 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT CYC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DACH1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation association, physical 16980615 , 17182846 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT DAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT DAZAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DBN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DBT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCAF13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCAF6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCAF7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCTN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCTN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DCXR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDOST anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDRGK1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX17 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX20 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX21 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, experimental interaction detection, pull down association, direct interaction, physical, physical association 11823437 , 25609649 , (Europe PMC )0.67 BioGRID, IntAct, MINT DDX23 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX24 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX27 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX39A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX3X anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX41 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX46 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX47 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX49 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX52 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX54 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX56 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DDX6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DEK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DEPDC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DES anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHRS7B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX16 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX29 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX30 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX36 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX37 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DHX9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DIMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DIRAS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DIS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DKC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLAT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLGAP5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DLST anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DMAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJA3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJB4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJC13 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJC7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNAJC9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DNMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DPF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DPM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DRG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DSG2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DSTN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DUS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DYNC1H1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DYNC1I2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT DYNC2H1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EBF3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT EBI-11323206 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EBNA1BP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ECH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF1A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF1B2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF1D Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT EEF1E1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF1G anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EEF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EFTUD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EGLN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2AK2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2B5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF2S3L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3D anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3E anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3F anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF3M anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF4A1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF4A3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF4G1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF5A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF5B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EIF6 {ECO:0000255|HAMAP-Rule:MF_03132, anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ELAVL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ELOB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ELP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EMG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ENO1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EPB41L3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EPB41L5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EPRS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ERI3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ERLIN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ERLIN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ETF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ETFA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EWSR1 Proximity Label-MS, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 14550555 , 24999758 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT EXD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EXOSC9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT EZR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAHD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAM98A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAM98B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FARSA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FARSB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FASN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FAU anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FBL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FBXO11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FBXO22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FEN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FHOD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FIGNL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FIP1L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FKBP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FKBP8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FLII anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FLNA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FLNC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FMR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FNBP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FOS Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Co-localization, FRET, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bimolecular fluorescence complementation, circular dichroism, display technology, fluorescent resonance energy transfer, isothermal titration calorimetry, peptide array, proximity ligation assay, tandem affinity purification, two hybrid, two hybrid pooling approach, x-ray crystallography association, direct interaction, physical, physical association 10488148 , 11053448 , 11090181 , 11431474 , 15319445 , 15718494 , 15994313 , 16008525 , 16055710 , 16714286 , 16928824 , 17440114 , 18172215 , 18848838 , 20102225 , 20195357 , 20410304 , 20498278 , 20511396 , 20936779 , 21199371 , 21675959 , 22719067 , 23602568 , 23661758 , 24029232 , 25609649 , 26186194 , 26496610 , 28514442 , 7816143 , 8380166 , 8440710 , 8617242 , 9160889 , 9872330 , (Europe PMC )0.96 BioGRID, IntAct, MINT FOSB Affinity Capture-MS, PCA, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , 29020630 , (Europe PMC )0.46 BioGRID, IntAct, MINT FOSL2 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification, two hybrid array, two hybrid prey pooling approach association, direct interaction, physical, physical association 20102225 , 25609649 , 26186194 , 26496610 , 28514442 , 9160889 , (Europe PMC )0.81 BioGRID, IntAct, MINT FOXRED1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FRG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FTSJ3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FUS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FXR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT FXR2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT G3BP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT G3BP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GABARAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GABARAPL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GAPDH anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GART anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GATAD2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GCN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GDI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GDI2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GEMIN4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GEMIN5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GFM2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GFPT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GLDC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GLUD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GMPS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNAI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNB1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GNL3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GOLGA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GOPC Affinity Capture-MS, Reconstituted Complex, display technology, tandem affinity purification association, physical, physical association 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT GOT2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPATCH11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPI anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GPX4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GRPEL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GRWD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GSR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GSTP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTF2I anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTF3C1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTF3C5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTPBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTPBP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GTSE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GYS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT GYS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H1F0 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H1FX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H2AFV anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H2AFY anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT H2AFY2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HACD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HADHA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HADHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HAT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HCFC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HDAC1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 17056544 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HDAC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HDLBP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HEATR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HEATR3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HERC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2AA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2AB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2AD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2BA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2BB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H2BC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST1H4A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST2H2BC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HIST3H3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HMMR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA0 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA1L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA2B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPA3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPAB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPCL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPD anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPDL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPH3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPM Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 11823437 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HNRNPR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPU anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPUL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HNRNPUL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HOXB9 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT HOXC13 tandem affinity purification association 25609649 , (Europe PMC )0.35 IntAct, MINT HOXD13 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT HP1BP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HPRT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HRAS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSD17B10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSD17B11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSD17B4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSDL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AA1 Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, display technology, two hybrid pooling approach association, physical, physical association 20195357 , 20936779 , 25609649 , (Europe PMC )0.68 BioGRID, IntAct, MINT HSP90AA2P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AA5P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AB2P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90AB3P anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSP90B1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA4L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPA8 Reconstituted Complex, anti bait coimmunoprecipitation, display technology association, physical, physical association 20195357 , 25609649 , (Europe PMC )0.56 BioGRID, IntAct, MINT HSPA9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HSPH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT HYOU1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT IBA57 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IDE anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IDH3B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGF2BP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGF2BP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGF2BP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGHA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IGLL5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IKBIP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ILF2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ILF3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ILKAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IMMT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IMP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IMPDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT INA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT INCENP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IPO8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IPO9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IQGAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT IRS4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ISG20L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ISOC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT JDP2 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 18671972 , 25609649 , (Europe PMC )0.60 BioGRID, IntAct, MINT JUN PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 10488148 , 20102225 , 21675959 , 25609649 , 7848298 , 8440710 , (Europe PMC )0.64 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 25609649 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUND Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT KARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KDM1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KHDRBS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KHSRP Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT KIF2A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIF5A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIF5B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIFAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIFC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KPNA2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid association, physical, physical association 21988832 , 25609649 , (Europe PMC )0.63 BioGRID, IntAct, MINT KPNA4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KPNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KRI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KRR1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KTN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LANCL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LAP3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP4B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARP7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LBR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LCP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LDHA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LDHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LETM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LETMD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LIG3 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT LMNA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LMNB1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LMNB2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LONP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRP5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRPPRC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRRC40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRRC47 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LRRC59 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LSG1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LSM12 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LYAR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LYZ anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAFF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAGED2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAGT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP1B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP1LC3A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP4K2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP4K4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP7D1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAP7D2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAPK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10419510 , 11431474 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MAPK10 Biochemical Activity, Reconstituted Complex, Two-hybrid, protein kinase assay, pull down, two hybrid direct interaction, phosphorylation reaction, physical, physical association 16007099 , 16824735 , 19527717 , 21988832 , 22327296 , 8654373 , 9596579 , (Europe PMC )0.76 BioGRID, IntAct, MINT MAPK8 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, in-gel kinase assay, protein kinase assay direct interaction, phosphorylation reaction, physical 10393177 , 10419510 , 10464310 , 10747973 , 10908726 , 10962563 , 10987838 , 11108663 , 11278395 , 11479302 , 11907583 , 12052834 , 12149229 , 12185592 , 12228228 , 12697749 , 12832416 , 12963725 , 13130464 , 14517282 , 14557262 , 14572659 , 14612408 , 14633987 , 14701799 , 15143066 , 15289320 , 15299005 , 15590691 , 15677475 , 15749833 , 15894542 , 15958389 , 16007099 , 16157600 , 16166642 , 16291755 , 16434970 , 16533805 , 16549498 , 16740711 , 16824735 , 16983342 , 17189706 , 17363973 , 17875713 , 18003900 , 18429822 , 18922473 , 18957422 , 19270716 , 19527717 , 19910486 , 20133937 , 20732415 , 22110360 , 22904686 , 23816567 , 25098452 , 8001819 , 8137421 , 8586671 , 8621542 , 8654373 , 8846788 , 9032244 , 9575168 , 9692890 , 9774977 , 9808624 , (Europe PMC )0.44, 0.85 BioGRID, IntAct, MINT MAPK9 Biochemical Activity, Reconstituted Complex, Two-hybrid, protein kinase assay phosphorylation reaction, physical 10490605 , 11278395 , 12788955 , 16533805 , 16824735 , 17189706 , 17875713 , 19527717 , 19910486 , 8001819 , 8654373 , 8945519 , 8985011 , 9596579 , (Europe PMC )0.44 BioGRID, IntAct, MINT MARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MATR3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MB21D2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCCC2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCM7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCTS1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MDC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MDH1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MDH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MECP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MEF2A Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT MEF2C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MEF2D Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MFAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MGST2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MICU2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MKI67 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MMTAG2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MOGS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MOV10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MPG anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MPP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRE11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL18 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL19 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL32 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL37 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL38 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL39 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL40 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL46 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPL58 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS15 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS18A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS18B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS22 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS26 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS27 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS31 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS33 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS34 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS35 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS7 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRPS9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MRS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MSH2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MSI1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MT-CO2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTA1 Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, direct interaction, physical 21555589 , 25609649 , (Europe PMC )0.59 BioGRID, IntAct, MINT MTA2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTDH Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 25609649 , 27956703 , (Europe PMC )0.35 BioGRID, IntAct, MINT MTHFD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTHFD1L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTHFR anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTPAP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MTREX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYBBP1A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYH10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYH11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYH14 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYH9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYL12A anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYL6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYL6B anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYLK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYO1C anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MYO6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAA50 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NACA Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation association, physical 25609649 , 9488446 , (Europe PMC )0.35 BioGRID, IntAct, MINT NAP1L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAP1L4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NARS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NAT10 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NBR1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT NCBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NCL anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFA6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFA9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFS3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFS8 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NDUFV2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NEFM anti bait coimmunoprecipitation, display technology association, physical association 20195357 , 25609649 , (Europe PMC )0.56 IntAct, MINT NELFB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 15530430 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NEMF anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NFATC1 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 25609649 , 27637333 , (Europe PMC )0.61 BioGRID, IntAct, MINT NFATC2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, pull down, tandem affinity purification association, direct interaction, physical, physical association 20557936 , 25609649 , 27637333 , (Europe PMC )0.35, 0.59 BioGRID, IntAct, MINT NFATC3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NFATC4 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NFIA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NFIX Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NIFK anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NIPSNAP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NKRF Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical 25609649 , (Europe PMC )0.46 BioGRID, IntAct, MINT NKX2-5 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NLE1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NMD3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOC2L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOC3L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOC4L anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOL11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOL6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOLC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOMO1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NONO anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP56 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP58 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOP9 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NOSIP anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NPEPPS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NPM1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NPM3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NR2F6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NRDC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NSUN2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NSUN5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDC anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDT16 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDT16L1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUDT21 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUP155 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NUSAP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NXF1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT OAT anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT OLA1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT ORC5 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT P4HB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PA2G4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PABPC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PABPC4 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PABPN1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PAICS anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PARP1 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 24636898 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PARS2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PAXBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PBDC1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCBP1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCBP2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCMT1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCMTD1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCMTD2 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PCNA anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDCD11 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDHB anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDHX anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDIA3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDIA6 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDK3 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PDS5A anti bait coimmunoprecipitation, tandem affinity purification association 25609649 , (Europe PMC )0.46 IntAct, MINT PELO anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT PES1 anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct