Top
MYC
Localization (UniProt annotation) Nucleus, nucleoplasm Nucleus, nucleolus Function (UniProt annotation) Transcription factor that binds DNA in a non-specificmanner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3' Activates the transcription of growth-related genesBinds to the VEGFA promoter, promoting VEGFA production andsubsequent sprouting angiogenesis (PubMed:24940000) Catalytic Activity (UniProt annotation) N/A Protein Sequence MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPF
SLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSG
SPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYP
AAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKAT
AYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
MYC is dephosphorylated by following phosphatases:
Phosphatase Gene Name Phosphatase UniProt_AC DephosphoSite and sequence (+/-5) in MYC (P01106) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction PPP2CB P62714 Ser-62_PTPPLsPSRRS, , Thr-58_FELLPtPPLSP , In vitro and in vivo 15048125 , 29535359 , Europe PMC PPP2CA P67775 Ser-62_PTPPLsPSRRS, , Thr-58_FELLPtPPLSP , In vitro and in vivo 15048125 , 29535359
, Europe PMC CTDSP1 Q9GZU7 Ser-62_PTPPLsPSRRS , in vitro and in vivo 25893300 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04012 ErbB signaling pathway The ErbB family of receptor tyrosine kinases (RTKs) couples binding of extracellular growth factor ligands to intracellular signaling pathways regulating diverse biologic responses, including proliferation, differentiation, cell motility, and survival. Ligand binding to the four closely related members of this RTK family -epidermal growth factor receptor (EGFR, also known as ErbB-1 or HER1), ErbB-2 (HER2), ErbB-3 (HER3), and ErbB-4 (HER4)-induces the formation of receptor homo- and heterodimers and the activation of the intrinsic kinase domain, resulting in phosphorylation on specific tyrosine residues (pY) within the cytoplasmic tail. Signaling effectors containing binding pockets for pY-containing peptides are recruited to activated receptors and induce the various signaling pathways. The Shc- and/or Grb2-activated mitogen-activated protein kinase (MAPK) pathway is a common target downstream of all ErbB receptors. Similarly, the phosphatidylinositol-3-kinase (PI-3K) pathway is directly or indirectly activated by most ErbBs. Several cytoplasmic docking proteins appear to be recruited by specific ErbB receptors and less exploited by others. These include the adaptors Crk, Nck, the phospholipase C gamma (PLCgamma), the intracellular tyrosine kinase Src, or the Cbl E3 ubiquitin protein ligase. hsa04110 Cell cycle Mitotic cell cycle progression is accomplished through a reproducible sequence of events, DNA replication (S phase) and mitosis (M phase) separated temporally by gaps known as G1 and G2 phases. Cyclin-dependent kinases (CDKs) are key regulatory enzymes, each consisting of a catalytic CDK subunit and an activating cyclin subunit. CDKs regulate the cell's progression through the phases of the cell cycle by modulating the activity of key substrates. Downstream targets of CDKs include transcription factor E2F and its regulator Rb. Precise activation and inactivation of CDKs at specific points in the cell cycle are required for orderly cell division. Cyclin-CDK inhibitors (CKIs), such as p16Ink4a, p15Ink4b, p27Kip1, and p21Cip1, are involved in the negative regulation of CDK activities, thus providing a pathway through which the cell cycle is negatively regulated.Eukaryotic cells respond to DNA damage by activating signaling pathways that promote cell cycle arrest and DNA repair. In response to DNA damage, the checkpoint kinase ATM phosphorylates and activates Chk2, which in turn directly phosphorylates and activates p53 tumor suppressor protein. p53 and its transcriptional targets play an important role in both G1 and G2 checkpoints. ATR-Chk1-mediated protein degradation of Cdc25A protein phosphatase is also a mechanism conferring intra-S-phase checkpoint activation. hsa04151 PI3K-Akt signaling pathway The phosphatidylinositol 3' -kinase(PI3K)-Akt signaling pathway is activated by many types of cellular stimuli or toxic insults and regulates fundamental cellular functions such as transcription, translation, proliferation, growth, and survival. The binding of growth factors to their receptor tyrosine kinase (RTK) or G protein-coupled receptors (GPCR) stimulates class Ia and Ib PI3K isoforms, respectively. PI3K catalyzes the production of phosphatidylinositol-3,4,5-triphosphate (PIP3) at the cell membrane. PIP3 in turn serves as a second messenger that helps to activate Akt. Once active, Akt can control key cellular processes by phosphorylating substrates involved in apoptosis, protein synthesis, metabolism, and cell cycle. hsa04218 Cellular senescence Cellular senescence is a state of irreversible cellular arrest and can be triggered by a number of factors, such as telomere shortening, oncogene activation, irradiation, DNA damage and oxidative stress. It is characterized by enlarged flattened morphology, senescence-associated beta-galactosidase (SA-b-gal) activity, secretion of inflammatory cytokines, growth factors and matrix metalloproteinases, as part of the senescence-associated secretory phenotype (SASP). Cellular senescence is functionally associated with many biological processes including aging, tumor suppression, placental biology, embryonic development, and wound healing. hsa04310 Wnt signaling pathway Wnt proteins are secreted morphogens that are required for basic developmental processes, such as cell-fate specification, progenitor-cell proliferation and the control of asymmetric cell division, in many different species and organs. There are at least three different Wnt pathways: the canonical pathway, the planar cell polarity (PCP) pathway and the Wnt/Ca2+ pathway. In the canonical Wnt pathway, the major effect of Wnt ligand binding to its receptor is the stabilization of cytoplasmic beta-catenin through inhibition of the bea-catenin degradation complex. Beta-catenin is then free to enter the nucleus and activate Wnt-regulated genes through its interaction with TCF (T-cell factor) family transcription factors and concomitant recruitment of coactivators. Planar cell polarity (PCP) signaling leads to the activation of the small GTPases RHOA (RAS homologue gene-family member A) and RAC1, which activate the stress kinase JNK (Jun N-terminal kinase) and ROCK (RHO-associated coiled-coil-containing protein kinase 1) and leads to remodelling of the cytoskeleton and changes in cell adhesion and motility. WNT-Ca2+ signalling is mediated through G proteins and phospholipases and leads to transient increases in cytoplasmic free calcium that subsequently activate the kinase PKC (protein kinase C) and CAMKII (calcium calmodulin mediated kinase II) and the phosphatase calcineurin. hsa04350 TGF-beta signaling pathway The transforming growth factor-beta (TGF-beta) family members, which include TGF-betas, activins and bone morphogenetic proteins (BMPs), are structurally related secreted cytokines found in species ranging from worms and insects to mammals. A wide spectrum of cellular functions such as proliferation, apoptosis, differentiation and migration are regulated by TGF-beta family members. TGF-beta family member binds to the Type II receptor and recruits Type I, whereby Type II receptor phosphorylates and activates Type I. The Type I receptor, in turn, phosphorylates receptor-activated Smads ( R-Smads: Smad1, Smad2, Smad3, Smad5, and Smad8). Once phosphorylated, R-Smads associate with the co-mediator Smad, Smad4, and the heteromeric complex then translocates into the nucleus. In the nucleus, Smad complexes activate specific genes through cooperative interactions with other DNA-binding and coactivator (or co-repressor) proteins. hsa04390 Hippo signaling pathway Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors. hsa04550 Signaling pathways regulating pluripotency of stem cells Pluripotent stem cells (PSCs) are basic cells with an indefinite self-renewal capacity and the potential to generate all the cell types of the three germinal layers. The types of PSCs known to date include embryonic stem (ES) and induced pluripotent stem (iPS) cells. ES cells are derived from the inner cell mass (ICM) of blastocyst-stage embryos. iPS cells are generated by reprogramming somatic cells back to pluripotent state with defined reprogramming factors, Oct4, Sox2, Klf4 and c-Myc (also known as Yamanaka factors). PSCs including ES cells and iPS cells are categorized into two groups by their morphology, gene expression profile and external signal dependence. Conventional mouse-type ES/iPS cells are called 'naive state' cells. They are mainly maintained under the control of LIF and BMP signaling. On the other hand, human-type ES/iPS cells, which are in need of Activin and FGF signaling, are termed 'primed state'. However, these signaling pathways converge towards the activation of a core transcriptional network that is similar in both groups and involves OCt4, Nanog and Sox2. The three transcription factors and their downstream target genes coordinately promote self-renewal and pluripotency. hsa04630 Jak-STAT signaling pathway The Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway is one of a handful of pleiotropic cascades used to transduce a multitude of signals for development and homeostasis in animals, from humans to flies. In mammals, the JAK/STAT pathway is the principal signaling mechanism for a wide array of cytokines and growth factors. Following the binding of cytokines to their cognate receptor, STATs are activated by members of the JAK family of tyrosine kinases. Once activated, they dimerize and translocate to the nucleus and modulate the expression of target genes. In addition to the activation of STATs, JAKs mediate the recruitment of other molecules such as the MAP kinases, PI3 kinase etc. These molecules process downstream signals via the Ras-Raf-MAP kinase and PI3 kinase pathways which results in the activation of additional transcription factors. hsa04919 Thyroid hormone signaling pathway The thyroid hormones (THs) are important regulators of growth, development and metabolism. The action of TH is mainly mediated by T3 (3,5,3'-triiodo-L-thyronine). Thyroid hormones, L-thyroxine (T4) and T3 enter the cell through transporter proteins. Although the major form of TH in the blood is T4, it is converted to the more active hormone T3 within cells. T3 binds to nuclear thyroid hormone receptors (TRs), which functions as a ligand-dependent transcription factor and controls the expression of target genes (genomic action). Nongenomic mechanisms of action is initiated at the integrin receptor. The plasma membrane alpha(v)beta(3)-integrin has distinct binding sites for T3 and T4. One binding site binds only T3 and activates the phosphatidylinositol 3-kinase (PI3K) pathway. The other binding site binds both T3 and T4 and activates the ERK1/2 MAP kinase pathway. hsa05161 Hepatitis B Hepatitis B virus (HBV) is an enveloped virus and contains a partially double-stranded relaxed circular DNA (RC-DNA) genome. After entry into hepatocytes, HBV RC-DNA is transported to the nucleus and converted into a covalently closed circular molecule cccDNA. The cccDNA is the template for transcription of all viral RNAs including the pregenomic RNA (pgRNA), encoding for 7 viral proteins: large, middle, and small envelope proteins (LHBs, MHBs, and SHBs) that form the surface antigen (HBsAg), the core antigen (HBcAg), the e antigen (HBeAg), the HBV polymerase, and the regulatory protein X (HBx). The pgRNA interacts with the viral polymerase protein to initiate the encapsidation into the core particles. Through endoplasmic reticulum, the core particles finish assembling with the envelope proteins and are released. HBV infection leads to a wide spectrum of liver diseases raging from chronic hepatitis, cirrhosis to hepatocellular carcinoma. The mechanism of liver injury is still not clear. However, HBV proteins target host proteins, involved in a variety of functions, thus regulating transcription, cellular signaling cascades, proliferation, differentiation, and apoptosis. hsa05163 Human cytomegalovirus infection Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells. hsa05166 Human T-cell leukemia virus 1 infection Human T-cell leukemia virus type 1 (HTLV-1) is a pathogenic retrovirus that is associated with adult T-cell leukemia/lymphoma (ATL). It is also strongly implicated in non-neoplastic chronic inflammatory diseases such as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Expression of Tax, a viral regulatory protein is critical to the pathogenesis. Tax is a transcriptional co-factor that interfere several signaling pathways related to anti-apoptosis or cell proliferation. The modulation of the signaling by Tax involve its binding to transcription factors like CREB/ATF, NF-kappa B, SRF, and NFAT. hsa05167 Kaposi sarcoma-associated herpesvirus infection Kaposi sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus 8 (HHV-8), is the most recently identified human tumor virus, and is associated with the pathogenesis of Kaposi's sarcoma (KS), primary effusion lymphoma (PEL), and Multicentric Castleman's disease (MCD). Like all other herpesviruses, KSHV displays two modes of life cycle, latency and lytic replication, which are characterized by the patterns of viral gene expression. Genes expressed in latency (LANA, v-cyclin, v-FLIP, Kaposins A, B and C and viral miRNAs) are mainly thought to facilitate the establishment of life long latency in its host and survival against the host innate, and adaptive immune surveillance mechanisms. Among the viral proteins shown to be expressed during lytic replication are potent signaling molecules such as vGPCR, vIL6, vIRFs, vCCLs, K1 and K15, which have been implicated experimentally in the angiogenic and inflammatory phenotype observed in KS lesions. Several of these latent viral and lytic proteins are known to transform host cells, linking KSHV with the development of severe human malignancies. hsa05169 Epstein-Barr virus infection Epstein-Barr virus (EBV) is a gamma-herpes virus that widely infects human populations predominantly at an early age but remains mostly asymptomatic. EBV has been linked to a wide spectrum of human malignancies, including nasopharyngeal carcinoma and other hematologic cancers, like Hodgkin's lymphoma, Burkitt's lymphoma (BL), B-cell immunoblastic lymphoma in HIV patients, and posttransplant-associated lymphoproliferative diseases. EBV has the unique ability to establish life-long latent infection in primary human B lymphocytes. During latent infection, EBV expresses a small subset of genes, including 6 nuclear antigens (EBNA-1, -2, -3A, -3B, -3C, and -LP), 3 latent membrane proteins (LMP-1, -2A, and -2B), 2 small noncoding RNAs (EBER-1 and 2). On the basis of these latent gene expression, three different latency patterns associated with the types of cancers are recognized. hsa05200 Pathways in cancer hsa05202 Transcriptional misregulation in cancer In tumor cells, genes encoding transcription factors (TFs) are often amplified, deleted, rearranged via chromosomal translocation and inversion, or subjected to point mutations that result in a gain- or loss-of- function. In hematopoietic cancers and solid tumors, the translocations and inversions increase or deregulate transcription of the oncogene. Recurrent chromosome translocations generate novel fusion oncoproteins, which are common in myeloid cancers and soft-tissue sarcomas. The fusion proteins have aberrant transcriptional function compared to their wild-type counterparts. These fusion transcription factors alter expression of target genes, and thereby result in a variety of altered cellular properties that contribute to the tumourigenic process. hsa05205 Proteoglycans in cancer Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors. hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. hsa05210 Colorectal cancer Colorectal cancer (CRC) is the second largest cause of cancer-related deaths in Western countries. CRC arises from the colorectal epithelium as a result of the accumulation of genetic alterations in defined oncogenes and tumour suppressor genes (TSG). Two major mechanisms of genomic instability have been identified in sporadic CRC progression. The first, known as chromosomal instability (CIN), results from a series of genetic changes that involve the activation of oncogenes such as K-ras and inactivation of TSG such as p53, DCC/Smad4, and APC. The second, known as microsatellite instability (MSI), results from inactivation of the DNA mismatch repair genes MLH1 and/or MSH2 by hypermethylation of their promoter, and secondary mutation of genes with coding microsatellites, such as transforming growth factor receptor II (TGF-RII) and BAX. Hereditary syndromes have germline mutations in specific genes (mutation in the tumour suppressor gene APC on chromosome 5q in FAP, mutated DNA mismatch repair genes in HNPCC). hsa05213 Endometrial cancer Endometrial cancer (EC) is the most common gynaecological malignancy and the fourth most common malignancy in women in the developed world after breast, colorectal and lung cancer. Two types of endometrial carcinoma are distinguished with respect to biology and clinical course. Type-I carcinoma is related to hyperestrogenism by association with endometrial hyperplasia, frequent expression of estrogen and progesterone receptors and younger age, whereas type-II carcinoma is unrelated to estrogen, associated with atrophic endometrium, frequent lack of estrogen and progesterone receptors and older age. The morphologic differences in these cancers are mirrored in their molecular genetic profile with type I showing defects in DNA-mismatch repair and mutations in PTEN, K-ras, and beta-catenin, and type II showing aneuploidy, p53 mutations, and her2/neu amplification. hsa05216 Thyroid cancer Thyroid cancer is the most common endocrine malignancy and accounts for the majority of endocrine cancer- related deaths each year. More than 95% of thyroid carcinomas are derived from follicular cells. Their behavior varies from the indolent growing, well-differentiated papillary and follicular carcinomas (PTC and FTC, respectively) to the extremely aggressive undifferentiated carcinoma (UC). Somatic rearrangements of RET and TRK are almost exclusively found in PTC and may be found in early stages. The most distinctive molecular features of FTC are the prominence of aneuploidy and the high prevalence of RAS mutations and PAX8-PPAR{gamma} rearrangements. p53 seems to play a crucial role in the dedifferentiation process of thyroid carcinoma. hsa05219 Bladder cancer The urothelium covers the luminal surface of almost the entire urinary tract, extending from the renal pelvis, through the ureter and bladder, to the proximal urethra. The majority of urothelial carcinoma are bladder carcinomas, and urothelial carcinomas of the renal pelvis and ureter account for only approximately 7% of the total. Urothelial tumours arise and evolve through divergent phenotypic pathways. Some tumours progress from urothelial hyperplasia to low-grade non-invasive superficial papillary tumours. More aggressive variants arise either from flat, high-grade carcinoma in situ (CIS) and progress to invasive tumours, or they arise de novo as invasive tumours. Low-grade papillary tumors frequently show a constitutive activation of the receptor tyrosine kinase-Ras pathway, exhibiting activating mutations in the HRAS and fibroblast growth factor receptor 3 (FGFR3) genes. In contrast, CIS and invasive tumors frequently show alterations in the TP53 and RB genes and pathways. Invasion and metastases are promoted by several factors that alter the tumour microenvironment, including the aberrant expression of E-cadherins (E-cad), matrix metalloproteinases (MMPs), angiogenic factors such as vascular endothelial growth factor (VEGF). hsa05220 Chronic myeloid leukemia Chronic myeloid leukemia (CML) is a clonal myeloproliferative disorder of a pluripotent stem cell. The natural history of CML has a triphasic clinical course comprising of an initial chronic phase (CP), which is characterized by expansion of functionally normal myeloid cells, followed by an accelerated phase (AP) and finally a more aggressive blast phase (BP), with loss of terminal differentiation capacity. On the cellular level, CML is associated with a specific chromosome abnormality, the t(9; 22) reciprocal translocation that forms the Philadelphia (Ph) chromosome. The Ph chromosome is the result of a molecular rearrangement between the c-ABL proto-oncogene on chromosome 9 and the BCR (breakpoint cluster region) gene on chromosome 22. The BCR/ABL fusion gene encodes p210 BCR/ABL, an oncoprotein, which, unlike the normal p145 c-Abl, has constitutive tyrosine kinase activity and is predominantly localized in the cytoplasm. While fusion of c-ABL and BCR is believed to be the primary cause of the chronic phase of CML, progression to blast crisis requires other molecular changes. Common secondary abnormalities include mutations in TP53, RB, and p16/INK4A, or overexpression of genes such as EVI1. Additional chromosome translocations are also observed,such as t(3;21)(q26;q22), which generates AML1-EVI1. hsa05221 Acute myeloid leukemia Acute myeloid leukemia (AML) is a disease that is characterized by uncontrolled proliferation of clonal neoplastic cells and accumulation in the bone marrow of blasts with an impaired differentiation program. AML accounts for approximately 80% of all adult leukemias and remains the most common cause of leukemia death. Two major types of genetic events have been described that are crucial for leukemic transformation. A proposed necessary first event is disordered cell growth and upregulation of cell survival genes. The most common of these activating events were observed in the RTK Flt3, in N-Ras and K-Ras, in Kit, and sporadically in other RTKs. Alterations in myeloid transcription factors governing hematopoietic differentiation provide second necessary event for leukemogenesis. Transcription factor fusion proteins such as AML-ETO, PML-RARalpha or PLZF-RARalpha block myeloid cell differentiation by repressing target genes. In other cases, the transcription factors themselves are mutated. hsa05222 Small cell lung cancer Lung cancer is a leading cause of cancer death among men and women in industrialized countries. Small cell lung carcinoma (SCLC) is a highly aggressive neoplasm, which accounts for approximately 25% of all lung cancer cases. Molecular mechanisms altered in SCLC include induced expression of oncogene, MYC, and loss of tumorsuppressor genes, such as p53, PTEN, RB, and FHIT. The overexpression of MYC proteins in SCLC is largely a result of gene amplification. Such overexpression leads to more rapid proliferation and loss of terminal differentiation. Mutation or deletion of p53 or PTEN can lead to more rapid proliferation and reduced apoptosis. The retinoblastoma gene RB1 encodes a nuclear phosphoprotein that helps to regulate cell-cycle progression. The fragile histidine triad gene FHIT encodes the enzyme diadenosine triphosphate hydrolase, which is thought to have an indirect role in proapoptosis and cell-cycle control. hsa05224 Breast cancer Breast cancer is the leading cause of cancer death among women worldwide. The vast majority of breast cancers are carcinomas that originate from cells lining the milk-forming ducts of the mammary gland. The molecular subtypes of breast cancer, which are based on the presence or absence of hormone receptors (estrogen and progesterone subtypes) and human epidermal growth factor receptor-2 (HER2), include: hormone receptor positive and HER2 negative (luminal A subtype), hormone receptor positive and HER2 positive (luminal B subtype), hormone receptor negative and HER2 positive (HER2 positive), and hormone receptor negative and HER2 negative (basal-like or triple-negative breast cancers (TNBCs)). Hormone receptor positive breast cancers are largely driven by the estrogen/ER pathway. In HER2 positive breast tumours, HER2 activates the PI3K/AKT and the RAS/RAF/MAPK pathways, and stimulate cell growth, survival and differentiation. In patients suffering from TNBC, the deregulation of various signalling pathways (Notch and Wnt/beta-catenin), EGFR protein have been confirmed. In the case of breast cancer only 8% of all cancers are hereditary, a phenomenon linked to genetic changes in BRCA1 or BRCA2. Somatic mutations in only three genes (TP53, PIK3CA and GATA3) occurred at >10% incidence across all breast cancers. hsa05225 Hepatocellular carcinoma Hepatocellular carcinoma (HCC) is a major type of primary liver cancer and one of the rare human neoplasms etiologically linked to viral factors. It has been shown that, after HBV/HCV infection and alcohol or aflatoxin B1 exposure, genetic and epigenetic changes occur. The recurrent mutated genes were found to be highly enriched in multiple key driver signaling processes, including telomere maintenance, TP53, cell cycle regulation, the Wnt/beta-catenin pathway (CTNNB1 and AXIN1), the phosphatidylinositol-3 kinase (PI3K)/AKT/mammalian target of rapamycin (mTOR) pathway. Recent studies using whole-exome sequencing have revealed recurrent mutations in new driver genes involved in the chromatin remodelling (ARID1A and ARID2) and the oxidative stress (NFE2L2) pathways. hsa05226 Gastric cancer Gastric cancer (GC) is one of the world's most common cancers. According to Lauren's histological classification gastric cancer is divided into two distinct histological groups - the intestinal and diffuse types. Several genetic changes have been identified in intestinal-type GC. The intestinal metaplasia is characterized by mutations in p53 gene, reduced expression of retinoic acid receptor beta (RAR-beta) and hTERT expression. Gastric adenomas furthermore display mutations in the APC gene, reduced p27 expression and cyclin E amplification. In addition, amplification and overexpression of c-ErbB2, reduced TGF-beta receptor type I (TGFBRI) expression and complete loss of p27 expression are commonly observed in more advanced GC. The main molecular changes observed in diffuse-type GCs include loss of E-cadherin function by mutations in CDH1 and amplification of MET and FGFR2F. hsa05230 Central carbon metabolism in cancer Malignant transformation of cells requires specific adaptations of cellular metabolism to support growth and survival. In the early twentieth century, Otto Warburg established that there are fundamental differences in the central metabolic pathways operating in malignant tissue. He showed that cancer cells consume a large amount of glucose, maintain high rate of glycolysis and convert a majority of glucose into lactic acid even under normal oxygen concentrations (Warburg's Effects). More recently, it has been recognized that the 'Warburg effect' encompasses a similarly increased utilization of glutamine. From the intermediate molecules provided by enhanced glycolysis and glutaminolysis, cancer cells synthesize most of the macromolecules required for the duplication of their biomass and genome. These cancer-specific alterations represent a major consequence of genetic mutations and the ensuing changes of signalling pathways in cancer cells. Three transcription factors, c-MYC, HIF-1 and p53, are key regulators and coordinate regulation of cancer metabolism in different ways, and many other oncogenes and tumor suppressor genes cluster along the signaling pathways that regulate c-MYC, HIF-1 and p53.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex. DREAM complex is evolutionarily conserved and is reponsible for transcriptional repressession of cell cycle-regulated genes in G0 and early G1 R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription. NICD1 produced by activation of NOTCH1 in response to Delta and Jagged ligands (DLL/JAG) presented in trans, traffics to the nucleus where it acts as a transcription regulator. In the nucleus, NICD1 displaces the NCOR corepressor complex from RBPJ (CSL). When bound to the co-repressor complex that includes NCOR proteins (NCOR1 and NCOR2) and HDAC histone deacetylases, RBPJ (CSL) represses transcription of NOTCH target genes (Kao et al. 1998, Zhou et al. 2000, Perissi et al. 2004, Perissi et al. 2008). Once the co-repressor complex is displaced, NICD1 recruits MAML (mastermind-like) to RBPJ, while MAML recruits histone acetyltransferases EP300 (p300) and PCAF, resulting in formation of the NOTCH coactivator complex that activates transcription from NOTCH regulatory elements. The minimal functional NOTCH coactivator complex that activates transcription from NOTCH regulatory elements is a heterotrimer composed of NICD, MAML and RBPJ (Fryer et al. 2002, Wallberg et al. 2002, Nam et al. 2006). NOTCH1 coactivator complex is known to activate transcription of HES1 (Jarriault et al. 1995), HES5 (Arnett et al. 2010), HEY genes (Fischer et al. 2004, Leimeister et al. 2000, Maier et al. 2000, Arnett et al. 2010) and MYC (Palomero et al. 2006) and likely regulates transcription of many other genes (Wang et al. 2011). NOTCH1 coactivator complex on any specific regulatory element may involve additional transcriptional regulatory proteins. HES1 binds TLE proteins, forming an evolutionarily conserved transcriptional corepressor involved in regulation of neurogenesis, segmentation and sex determination (Grbavec et al. 1996, Fisher et al. 1996, Paroush et al. 1994). After NOTCH1 coactivator complex is assembled on a NOTCH-responsive promoter, MAML (mastermind-like) recruits CDK8 in complex with cyclin C, triggering phosphorylation of conserved serine residues in TAD and PEST domains of NICD1 by CDK8. Phosphorylated NICD1 is recognized by the E3 ubiquitin ligase FBXW7 which ubiquitinates NICD1, leading to degradation of NICD1 and downregulation of NOTCH1 signaling. FBXW7-mediated ubiquitination and degradation of NOTCH1 depend on C-terminally located PEST domain sequences in NOTCH1 (Fryer et al. 2004, Oberg et al. 2001, Wu et al. 2001). The PEST domain of NOTCH1 and the substrate binding WD40 domain of FBXW7 are frequent targets of mutations in T-cell acute lymphoblastic leukemia - T-ALL (Welcker and Clurman 2008). NICD1, which normally has a short half-life, can be stabilized by binding to the hypoxia-inducable factor 1-alpha (HIF1A) which accumulates in the nucleus when oxygen levels are low. This results in HIF1A-induced inhibition of cellular differentiation that is NOTCH-dependent (Gustafsson et al. 2005) R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription. After phosphorylated SMAD2 and/or SMAD3 form a heterotrimer with SMAD4, SMAD2/3:SMAD4 complex translocates to the nucleus (Xu et al. 2000, Kurisaki et al. 2001, Xiao et al. 2003). In the nucleus, linker regions of SMAD2 and SMAD3 within SMAD2/3:SMAD4 complex can be phosphorylated by CDK8 associated with cyclin C (CDK8:CCNC) or CDK9 associated with cyclin T (CDK9:CCNT). CDK8/CDK9-mediated phosphorylation of SMAD2/3 enhances transcriptional activity of SMAD2/3:SMAD4 complex, but also primes it for ubiquitination and consequent degradation (Alarcon et al. 2009). The transfer of SMAD2/3:SMAD4 complex to the nucleus can be assisted by other proteins, such as WWTR1. In human embryonic cells, WWTR1 (TAZ) binds SMAD2/3:SMAD4 heterotrimer and mediates TGF-beta-dependent nuclear accumulation of SMAD2/3:SMAD4. The complex of WWTR1 and SMAD2/3:SMAD4 binds promoters of SMAD7 and SERPINE1 (PAI-1 i.e. plasminogen activator inhibitor 1) genes and stimulates their transcription (Varelas et al. 2008). Stimulation of SMAD7 transcription by SMAD2/3:SMAD4 represents a negative feedback loop in TGF-beta receptor signaling. SMAD7 can be downregulated by RNF111 ubiquitin ligase (Arkadia), which binds and ubiquitinates SMAD7, targeting it for degradation (Koinuma et al. 2003). SMAD2/3:SMAD4 heterotrimer also binds the complex of RBL1 (p107), E2F4/5 and TFDP1/2 (DP1/2). The resulting complex binds MYC promoter and inhibits MYC transcription. Inhibition of MYC transcription contributes to anti-proliferative effect of TGF-beta (Chen et al. 2002). SMAD2/3:SMAD4 heterotrimer also associates with transcription factor SP1. SMAD2/3:SMAD4:SP1 complex stimulates transcription of a CDK inhibitor CDKN2B (p15-INK4B), also contributing to the anti-proliferative effect of TGF-beta (Feng et al. 2000). MEN1 (menin), a transcription factor tumor suppressor mutated in a familial cancer syndrome multiple endocrine neoplasia type 1, forms a complex with SMAD2/3:SMAD4 heterotrimer, but transcriptional targets of SMAD2/3:SMAD4:MEN1 have not been elucidated (Kaji et al. 2001, Sowa et al. 2004, Canaff et al. 2012). JUNB is also an established transcriptional target of SMAD2/3:SMAD4 complex (Wong et al. 1999) R-HSA-2644606 Constitutive Signaling by NOTCH1 PEST Domain Mutants. As NOTCH1 PEST domain is intracellular, NOTCH1 PEST domain mutants are expected to behave as the wild-type NOTCH1 with respect to ligand binding and proteolytic cleavage mediated activation of signaling. However, once the NICD1 fragment of NOTCH1 is released, PEST domain mutations prolong its half-life and transcriptional activity through interference with FBXW7 (FBW7)-mediated ubiquitination and degradation of NICD1 (Weng et al. 2004, Thompson et al. 2007, O'Neil et al. 2007). All NOTCH1 PEST domain mutants annotated here (NOTCH1 Q2395*, NOTCH1 Q2440*, NOTCH1 P2474Afs*4 and NOTCH1 P2514Rfs*4) either have a truncated PEST domain or lack the PEST domain completely R-HSA-2894862 Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants. When found in cis, HD and PEST domain mutations act synergistically, increasing NOTCH1 transcriptional activity up to ~40-fold, compared with up to ~10-fold and up to ~2-fold increase with HD mutations alone and PEST domain mutations alone, respectively (Weng et al. 2004). HD domain mutations enable spontaneous, ligand-independent, proteolytic release of the NICD1 fragment, although mutants remain responsive to ligand binding (Malecki et al. 2006), while PEST domain mutations prolong NICD1 half-life and transcriptional activity through interference with FBXW7 (FBW7)-mediated ubiquitination and degradation (Thompson et al. 2007, O'Neil et al. 2007). NOTCH1 HD+PEST domain mutants annotated here are NOTCH1 L1600P;P2514Rfs*4, NOTCH1 L1600P;Q2440*, NOTCH1 L1600P;Q2395* and NOTCH1 L1574P;P2474Afs*4 R-HSA-4411364 Binding of TCF/LEF:CTNNB1 to target gene promoters. The genes regulated by beta-catenin and TCF/LEF are involved in a diverse range of functions in cellular proliferation, differentiation, embryogenesis and tissue homeostasis, and include transcription factors, cell cycle regulators, growth factors, proteinases and inflammatory cytokines, among others (reviewed in Vlad et al, 2008). A number of WNT signaling components are themselves positively or negatively regulated targets of TCF/LEF-dependent transcription, establishing feedback loops to enhance or restrict signaling (see for instance, Khan et al 2007; Chamorro et al, 2005; Roose et al, 1999; Lustig et al, 2002). Other than a few of these general feedback targets (e.g. Axin2), most target genes are cell- and/or tissue-specific. A list of WNT/beta-catenin-dependent target genes is maintained at http://www.standford.edu/group/nusselab/cgi-bin/wnt/target_genes R-HSA-5687128 MAPK6/MAPK4 signaling. MAPK6 and MAPK4 (also known as ERK3 and ERK4) are vertebrate-specific atypical MAP kinases. Atypical MAPK are less well characterized than their conventional counterparts, and are generally classified as such based on their lack of activation by MAPKK family members. Unlike the conventional MAPK proteins, which contain a Thr-X-Tyr motif in the activation loop, MAPK6 and 4 have a single Ser-Glu-Gly phospho-acceptor motif (reviewed in Coulombe and Meloche, 2007; Cargnello et al, 2011). MAPK6 is also distinct in being an unstable kinase, whose turnover is mediated by ubiquitin-dependent degradation (Coulombe et al, 2003; Coulombe et al, 2004). The biological functions and pathways governing MAPK6 and 4 are not well established. MAPK6 and 4 are phosphorylated downstream of class I p21 activated kinases (PAKs) in a RAC- or CDC42-dependent manner (Deleris et al, 2008; Perander et al, 2008; Deleris et al, 2011; De La Mota-Peynado et al, 2011). One of the only well established substrates of MAPK6 and 4 is MAPKAPK5, which contributes to cell motility by promoting the HSBP1-dependent rearrangement of F-actin (Gerits et al, 2007; Kostenko et al, 2009a; reviewed in Kostenko et al, 2011b). The atypical MAPKs also contribute to cell motility and invasiveness through the NCOA3:ETV4-dependent regulation of MMP gene expression (Long et al, 2012; Yan et al, 2008; Qin et al, 2008) R-HSA-5689880 Ub-specific processing proteases. Ub-specific processing proteases (USPs) are the largest of the DUB families with more than 50 members in humans. The USP catalytic domain varies considerably in size and consists of six conserved motifs with N- or C-terminal extensions and insertions occurring between the conserved motifs (Ye et al. 2009). Two highly conserved regions comprise the catalytic triad, the Cys-box (Cys) and His-box (His and Asp/Asn) (Nijman et al. 2005, Ye et al. 2009, Reyes-Turcu & Wilkinson 2009). They recognize their substrates by interactions of the variable regions with the substrate protein directly, or via scaffolds or adapters in multiprotein complexes R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling. Interleukin-4 (IL4) is a principal regulatory cytokine during the immune response, crucially important in allergy and asthma (Nelms et al. 1999). When resting T cells are antigen-activated and expand in response to Interleukin-2 (IL2), they can differentiate as Type 1 (Th1) or Type 2 (Th2) T helper cells. The outcome is influenced by IL4. Th2 cells secrete IL4, which both stimulates Th2 in an autocrine fashion and acts as a potent B cell growth factor to promote humoral immunity (Nelms et al. 1999). Interleukin-13 (IL13) is an immunoregulatory cytokine secreted predominantly by activated Th2 cells. It is a key mediator in the pathogenesis of allergic inflammation. IL13 shares many functional properties with IL4, stemming from the fact that they share a common receptor subunit. IL13 receptors are expressed on human B cells, basophils, eosinophils, mast cells, endothelial cells, fibroblasts, monocytes, macrophages, respiratory epithelial cells, and smooth muscle cells, but unlike IL4, not T cells. Thus IL13 does not appear to be important in the initial differentiation of CD4 T cells into Th2 cells, rather it is important in the effector phase of allergic inflammation (Hershey et al. 2003).\n\nIL4 and IL13 induce “alternative activation” of macrophages, inducing an anti-inflammatory phenotype by signaling through IL4R alpha in a STAT6 dependent manner. This signaling plays an important role in the Th2 response, mediating anti-parasitic effects and aiding wound healing (Gordon & Martinez 2010, Loke et al. 2002)\n\nThere are two types of IL4 receptor complex (Andrews et al. 2006). Type I IL4R (IL4R1) is predominantly expressed on the surface of hematopoietic cells and consists of IL4R and IL2RG, the common gamma chain. Type II IL4R (IL4R2) is predominantly expressed on the surface of nonhematopoietic cells, it consists of IL4R and IL13RA1 and is also the type II receptor for IL13. (Obiri et al. 1995, Aman et al. 1996, Hilton et al. 1996, Miloux et al. 1997, Zhang et al. 1997). The second receptor for IL13 consists of IL4R and Interleukin-13 receptor alpha 2 (IL13RA2), sometimes called Interleukin-13 binding protein (IL13BP). It has a high affinity receptor for IL13 (Kd = 250 pmol/L) but is not sufficient to render cells responsive to IL13, even in the presence of IL4R (Donaldson et al. 1998). It is reported to exist in soluble form (Zhang et al. 1997) and when overexpressed reduces JAK-STAT signaling (Kawakami et al. 2001). It's function may be to prevent IL13 signalling via the functional IL4R:IL13RA1 receptor. IL13RA2 is overexpressed and enhances cell invasion in some human cancers (Joshi & Puri 2012).The first step in the formation of IL4R1 (IL4:IL4R:IL2RB) is the binding of IL4 with IL4R (Hoffman et al. 1995, Shen et al. 1996, Hage et al. 1999). This is also the first step in formation of IL4R2 (IL4:IL4R:IL13RA1). After the initial binding of IL4 and IL4R, IL2RB binds (LaPorte et al. 2008), to form IL4R1. Alternatively, IL13RA1 binds, forming IL4R2. In contrast, the type II IL13 complex (IL13R2) forms with IL13 first binding to IL13RA1 followed by recruitment of IL4R (Wang et al. 2009).Crystal structures of the IL4:IL4R:IL2RG, IL4:IL4R:IL13RA1 and IL13:IL4R:IL13RA1 complexes have been determined (LaPorte et al. 2008). Consistent with these structures, in monocytes IL4R is tyrosine phosphorylated in response to both IL4 and IL13 (Roy et al. 2002, Gordon & Martinez 2010) while IL13RA1 phosphorylation is induced only by IL13 (Roy et al. 2002, LaPorte et al. 2008) and IL2RG phosphorylation is induced only by IL4 (Roy et al. 2002).Both IL4 receptor complexes signal through Jak/STAT cascades. IL4R is constitutively-associated with JAK2 (Roy et al. 2002) and associates with JAK1 following binding of IL4 (Yin et al. 1994) or IL13 (Roy et al. 2002). IL2RG constitutively associates with JAK3 (Boussiotis et al. 1994, Russell et al. 1994). IL13RA1 constitutively associates with TYK2 (Umeshita-Suyama et al. 2000, Roy et al. 2002, LaPorte et al. 2008, Bhattacharjee et al. 2013). IL4 binding to IL4R1 leads to phosphorylation of JAK1 (but not JAK2) and STAT6 activation (Takeda et al. 1994, Ratthe et al. 2007, Bhattacharjee et al. 2013). IL13 binding increases activating tyrosine-99 phosphorylation of IL13RA1 but not that of IL2RG. IL4 binding to IL2RG leads to its tyrosine phosphorylation (Roy et al. 2002). IL13 binding to IL4R2 leads to TYK2 and JAK2 (but not JAK1) phosphorylation (Roy & Cathcart 1998, Roy et al. 2002).Phosphorylated TYK2 binds and phosphorylates STAT6 and possibly STAT1 (Bhattacharjee et al. 2013). A second mechanism of signal transduction activated by IL4 and IL13 leads to the insulin receptor substrate (IRS) family (Kelly-Welch et al. 2003). IL4R1 associates with insulin receptor substrate 2 and activates the PI3K/Akt and Ras/MEK/Erk pathways involved in cell proliferation, survival and translational control. IL4R2 does not associate with insulin receptor substrate 2 and consequently the PI3K/Akt and Ras/MEK/Erk pathways are not activated (Busch-Dienstfertig & González-Rodríguez 2013) R-HSA-69202 Cyclin E associated events during G1/S transition. The transition from the G1 to S phase is controlled by the Cyclin E:Cdk2 complexes. As the Cyclin E:Cdk2 complexes are formed, the Cdk2 is phosphorylated by the Wee1 and Myt1 kinases. This phosphorylation keeps the Cdk2 inactive. In yeast this control is called the cell size checkpoint control. The dephosphorylation of the Cdk2 by Cdc25A activates the Cdk2, and is coordinated with the cells reaching the proper size, and with the DNA synthesis machinery being ready. The Cdk2 then phosphorylates G1/S specific proteins, including proteins required for DNA replication initiation. The beginning of S-phase is marked by the first nucleotide being laid down on the primer during DNA replication at the early-firing origins.Failure to appropriately regulate cyclin E accumulation can lead to accelerated S phase entry, genetic instability, and tumorigenesis. The amount of\n cyclin E protein in the cell is controlled by ubiquitin-mediated proteolysis (see Woo, 2003).This pathway has not yet been annotated in Reactome R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry. Cyclin A:Cdk2 plays a key role in S phase entry by phosphorylation of proteins including Cdh1, Rb, p21 and p27. During G1 phase of the cell cycle, cyclin A is synthesized and associates with Cdk2. After forming in the cytoplasm, the Cyclin A:Cdk2 complexes are translocated to the nucleus (Jackman et al.,2002). Prior to S phase entry, the activity of Cyclin A:Cdk2 complexes is negatively regulated through Tyr 15 phosphorylation of Cdk2 (Gu et al., 1995) and also by the association of the cyclin kinase inhibitors (CKIs), p27 and p21. Phosphorylation of cyclin-dependent kinases (CDKs) by the CDK-activating kinase (CAK) is required for the activation of the CDK2 kinase activity (Aprelikova et al., 1995). The entry into S phase is promoted by the removal of inhibitory Tyr 15 phosphates from the Cdk2 subunit of Cyclin A:Cdk2 complex by the Cdc25 phosphatases (Blomberg and Hoffmann, 1999) and by SCF(Skp2)-mediated degradation of p27/p21 (see Ganoth et al., 2001). \r\nWhile Cdk2 is thought to play a primary role in regulating entry into S phase, recent evidence indicates that Cdk1 is equally capable of promoting entry into S phase and the initiation of DNA replication (see Bashir and Pagano, 2005). Thus, Cdk1 complexes may also play a significant role at this point in the cell cycle R-HSA-8866911 TFAP2 (AP-2) family regulates transcription of cell cycle factors. TFAP2A and TFAP2C play opposing roles in transcriptional regulation of the CDKN1A (p21) gene locus. While TFAP2A stimulates transcription of the CDKN1A cyclin-dependent kinase inhibitor (Zeng et al. 1997, Williams et al. 2009, Scibetta et al. 2010), TFAP2C, in cooperation with MYC and histone demethylase KDM5B, represses CDKN1A transcription (Williams et al. 2009, Scibetta et al. 2010, Wong et al. 2012) R-HSA-8951430 RUNX3 regulates WNT signaling. RUNX3 binds to complexes of beta-catenin (CTNNB1) and TCF/LEF family members. Binding of RUNX3 to CTNNB1:TCF/LEF complexes prevents their loading onto cyclin D1 (CCND1) and MYC gene promoters and interferes with WNT signaling-mediated activation of CCND1 and MYC1 transcription. RUNX3 therefore inhibits WNT-induced cellular proliferation (Ito et al. 2008) R-HSA-9018519 Estrogen-dependent gene expression. Estrogens mediate their transcriptional effects through interaction with the estrogen receptors, ESR1 (also known as ER alpha) and ESR2 (ER beta). ESR1 and ESR2 share overlapping but distinct functions, with ESR1 playing the primary role in transcriptional activation in most cell types (Hah and Krauss, 2014; Haldosén et al, 2014. The receptors function as ligand-dependent dimers and can activate target genes either through direct binding to an estrogen responsive element (ERE) in the target gene promoter, or indirectly through interaction with another DNA-binding protein such as RUNX1, SP1, AP1 or NF-kappa beta (reviewed in Bai and Gust, 2009; Hah and Krause, 2014). Binding of estrogen receptors to the DNA promotes the assembly of higher order transcriptional complexes containing methyltransferases, histone acetyltransferases and other transcriptional activators, which promote transcription by establishing active chromatin marks and by recruiting general transcription factors and RNA polymerase II. ESR1- and estrogen-dependent recruitment of up to hundreds of coregulators has been demonstrated by varied co-immunoprecipitation and proteomic approaches (Kittler et al, 2013; Mohammed et al, 2013; Foulds et al, 2013; Mohammed et al, 2015; Liu et al, 2014; reviewed in Magnani and Lupien, 2014; Arnal, 2017). In some circumstances, ligand-bound receptors can also promote the assembly of a repression complex at a target gene, and in some cases, heterodimers of ESR1 and ESR2 serve as repressors of ESR1-mediated target gene activation (reviewed in Hah and Kraus, 2014; Arnal et al, 2017). Phosphorylation of the estrogen receptor also modulates its activity, and provides cross-talk between nuclear estrogen-dependent signaling and non-genomic estrogen signaling from the plasma membrane (reviewed in Anbalagan and Rowan, 2015; Halodsèn et al, 2014; Schwartz et al, 2016) A number of recent genome wide studies highlight the breadth of the transcriptional response to estrogen. The number of predicted estrogen-dependent target genes ranges from a couple of hundred (based on microarray studies) to upwards of 10000, based on ChIP-chip or ChIP-seq (Cheung and Kraus, 2010; Kinnis and Kraus, 2008; Lin et al, 2004; Welboren et al, 2009; Ikeda et al, 2015; Lin et al, 2007; Carroll et al, 2006). Many of these predicted sites may not represent transcriptionally productive binding events, however. A study examining ESR1 binding by ChIP-seq in 20 primary breast cancers identified a core of 484 ESR-binding events that were conserved in at least 75% of ER+ tumors, which may represent a more realistic estimate (Ross-Innes et al, 2012). These studies also highlight the long-range effect of estrogen receptor-binding, with distal enhancer or promoter elements regulating the expression of many target genes, often through looping or other higher order chromatin structures (Kittler et al, 2013; reviewed in Dietz and Carroll, 2008; Liu and Cheung, 2014; Magnani and Lupien, 2014). Transcription from a number of estrogen-responsive target genes also appears to be primed by the binding of pioneering transcription factors such as FOXA1, GATA3, PBX1 among others
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ACOT8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ACTB Co-purification physical 11839798 , (Europe PMC )NA BioGRID ACTC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ACTG1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ACTL6A Affinity Capture-MS, Affinity Capture-Western, Co-purification, tandem affinity purification association, physical 11839798 , 17314511 , 25609649 , (Europe PMC )0.53 BioGRID, IntAct, MINT ACTL8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAR Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADIPOR1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID ADNP Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AFAP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AIFM2 Dosage Lethality, tandem affinity purification association, genetic 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct AKAP6 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID AKAP8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct AKAP8L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDH18A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDH1B1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDOA Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID ALPK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID AMBRA1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 25438055 , (Europe PMC )0.40 BioGRID, IntAct ANGPTL4 Co-purification physical 22573825 , (Europe PMC )NA BioGRID ANXA2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct APP Reconstituted Complex physical 21244100 , (Europe PMC )NA BioGRID ARF4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ARFGEF2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID ARHGEF2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct ARL1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ASS1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID ATAD2 Affinity Capture-Western, Reconstituted Complex physical 19843847 , (Europe PMC )NA BioGRID ATP5F1C Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID ATP5F1D Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID ATP5MF Affinity Capture-MS physical 17314511 , 21150319 , (Europe PMC )NA BioGRID ATXN10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AXIN1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, direct interaction, physical, physical association 19131971 , (Europe PMC )0.62 BioGRID, IntAct, MINT B4GALT7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BCL2 Affinity Capture-Western, Co-localization physical 15210690 , (Europe PMC )NA BioGRID BCR Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct BIN1 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, two hybrid direct interaction, physical, physical association 10380878 , 15992821 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT BLM Affinity Capture-Western, Reconstituted Complex physical 23750012 , (Europe PMC )NA BioGRID BMPR1A Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BNIP2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BOK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 11916966 , 12646176 , 14612409 , 20215511 , 9788437 , (Europe PMC )NA BioGRID BRD3 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct BRD4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BRD8 Affinity Capture-MS physical 20946988 , (Europe PMC )NA BioGRID BRPF1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID BTK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western, Biochemical Activity physical 20852628 , (Europe PMC )NA BioGRID C17orf49 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID C1QBP Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CALM1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CAMK1G Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CAMK2D Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct CAMK2G Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CARM1 Affinity Capture-Western physical 15616592 , (Europe PMC )NA BioGRID CAVIN1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CAVIN3 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CBFB Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CCAR2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , 22190494 , (Europe PMC )0.75 BioGRID, IntAct CCNH Reconstituted Complex physical 11673469 , (Europe PMC )NA BioGRID CCNK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CCNT1 Affinity Capture-Western, Reconstituted Complex physical 11673469 , 12944920 , 17700062 , 19818711 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT6A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CD6 Affinity Capture-Western physical 10899308 , (Europe PMC )NA BioGRID CDC6 Reconstituted Complex physical 10899308 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-Western, Protein-peptide physical 26687678 , (Europe PMC )NA BioGRID CDCA7L Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation physical, physical association 15994933 , 16829576 , (Europe PMC )0.40 BioGRID, IntAct CDH5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CDK12 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CDK16 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID CDK2 Dosage Lethality, Synthetic Lethality genetic 22623531 , 25495526 , (Europe PMC )NA BioGRID CDK4 Biochemical Activity, Two-hybrid, protein kinase assay, two hybrid array phosphorylation reaction, physical, physical association 21988832 , 22094256 , (Europe PMC )0.59 BioGRID, IntAct CDK6 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22094256 , (Europe PMC )0.44 BioGRID, IntAct CDK8 Reconstituted Complex physical 11673469 , (Europe PMC )NA BioGRID CDK9 Affinity Capture-Western, Reconstituted Complex physical 11673469 , 12944920 , 17700062 , 19818711 , 26687678 , (Europe PMC )NA BioGRID CDKN1B Affinity Capture-Western, PCA physical 26701207 , (Europe PMC )NA BioGRID CDKN2A Affinity Capture-Western physical 17289033 , 20308430 , 23277542 , (Europe PMC )NA BioGRID CDR2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10465786 , 20383333 , (Europe PMC )NA BioGRID CDYL Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CEBPA Affinity Capture-Western physical 12873812 , (Europe PMC )NA BioGRID CEBPB Affinity Capture-Western physical 12873812 , (Europe PMC )NA BioGRID CECR2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CENPF Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CENPO Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CEP57 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct CEPT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CHCHD3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CHD4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , (Europe PMC )0.50 BioGRID, IntAct CHD9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHTF18 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 21575199 , (Europe PMC )0.46 BioGRID, IntAct CIP2A Affinity Capture-Western, Reconstituted Complex physical 17632056 , (Europe PMC )NA BioGRID CKAP4 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CNMD Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID COPG1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct COPG2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CPS1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CRADD Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 12776737 , 16878156 , (Europe PMC )NA BioGRID CSE1L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CSNK1E Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CSNK2A1 Biochemical Activity physical 12149649 , (Europe PMC )NA BioGRID CTNND1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CTPS1 Affinity Capture-MS, Dosage Lethality genetic, physical 21150319 , 22623531 , (Europe PMC )NA BioGRID CTR9 Affinity Capture-Western, tandem affinity purification association, physical 21150319 , 26687678 , (Europe PMC )0.35 BioGRID, IntAct CTSD Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western physical 12769844 , (Europe PMC )NA BioGRID CUL4A Affinity Capture-Western physical 20551172 , (Europe PMC )NA BioGRID CXXC1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CYC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CYR61 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DCAF8 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID DDB1 Affinity Capture-Western physical 20551172 , (Europe PMC )NA BioGRID DDB2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID DDX1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DDX17 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct DDX20 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct DDX24 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct DDX52 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DHX15 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DIMT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DMAP1 Affinity Capture-Western physical 20946988 , (Europe PMC )NA BioGRID DNAJA2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNAJA3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNAJB11 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct DNAJB12 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID DNAJB6 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNMT3A Affinity Capture-Western, Reconstituted Complex physical 15616584 , 19786833 , (Europe PMC )NA BioGRID DPM1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct DYNC1H1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ECSIT Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct EEF1G Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct EFNA5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID EFNB1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct EFTUD2 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.68 BioGRID, IntAct EIF3I Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID EIF4A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct EIF4ENIF1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELF3 Biochemical Activity physical 1651323 , (Europe PMC )NA BioGRID ELP1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID EP300 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15616592 , 16126174 , 16287840 , 17157259 , (Europe PMC )0.40 BioGRID, IntAct EP400 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11509179 , 17314511 , 18413597 , 20946988 , 21150319 , (Europe PMC )0.40, 0.67 BioGRID, IntAct EPC1 Affinity Capture-MS, tandem affinity purification association, physical 20946988 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct EPC2 Affinity Capture-MS physical 20946988 , (Europe PMC )NA BioGRID ERBIN Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID ERC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ERCC3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ERN1 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western physical 16455494 , (Europe PMC )NA BioGRID ETFA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ETV3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct EXOC4 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct EYA1 Affinity Capture-Western, Biochemical Activity physical 27795300 , (Europe PMC )NA BioGRID FAM131C Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID FANCD2 Affinity Capture-MS, Co-localization, tandem affinity purification association, physical 17314511 , 24658369 , (Europe PMC )0.35 BioGRID, IntAct FANCI Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct FBL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct FBXO5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID FBXO8 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 20848231 , (Europe PMC )NA BioGRID FBXW7 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 15103331 , 15150404 , 15498494 , 17157259 , 17314511 , 17646408 , 17873522 , 20848231 , 20970423 , 22524983 , 23750012 , 25716680 , 25720964 , 27795300 , 28007894 , 28209614 , (Europe PMC )NA BioGRID FBXW8 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 17314511 , (Europe PMC )0.57 BioGRID, IntAct FHL2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FLNA Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOSL1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOXO3 Affinity Capture-Western physical 18393360 , (Europe PMC )NA BioGRID FOXO6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOXR1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXR2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT GALR3 Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID GANAB Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct GCDH Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GCHFR Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS, Two-hybrid physical 17314511 , 17353931 , 20936779 , (Europe PMC )NA BioGRID GEMIN4 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GLI1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GNRHR Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GPX2 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GRK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GRK3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GSK3A Affinity Capture-Western, Reconstituted Complex physical 14563837 , (Europe PMC )NA BioGRID GSK3B Affinity Capture-Western, Split renilla luciferase complementation, Synthetic Lethality, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 14563837 , 19131971 , 20713710 , 21150319 , 25495526 , (Europe PMC )0.37, 0.60 BioGRID, IntAct, MINT GTF2F1 Reconstituted Complex physical 8755740 , (Europe PMC )NA BioGRID GTF2H4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GTF2I Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, tandem affinity purification association, physical 17314511 , 8377829 , (Europe PMC )0.35 BioGRID, IntAct GTF3C1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GTF3C2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GTF3C3 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct GTF3C4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct HADHA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HADHB Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 21150319 , 26496610 , (Europe PMC )0.64 BioGRID, IntAct HASPIN Affinity Capture-MS, Dosage Lethality genetic, physical 17314511 , 22623531 , (Europe PMC )NA BioGRID HAUS7 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HBP1 Affinity Capture-Western, Two-hybrid physical 20008325 , (Europe PMC )NA BioGRID HCK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HDAC1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 18003922 , 18271930 , 22286234 , 24951594 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct HDAC2 Affinity Capture-MS, Affinity Capture-Western, display technology, tandem affinity purification association, physical, physical association 17314511 , 20195357 , 22286234 , (Europe PMC )0.56 BioGRID, IntAct HDAC3 Affinity Capture-Western, anti bait coimmunoprecipitation, chromatin immunoprecipitation assay association, physical 18483244 , 22002311 , 23079660 , (Europe PMC )0.46 BioGRID, IntAct HEATR1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HECTD3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HELLS Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID HELZ Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western physical 15071503 , (Europe PMC )NA BioGRID HIGD1A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HIST1H2BL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPA0 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct HNRNPD Protein-RNA physical 23603392 , (Europe PMC )NA BioGRID HNRNPF Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPK Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPU Affinity Capture-Western physical 19578763 , (Europe PMC )NA BioGRID HPS1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HSD17B4 Dosage Lethality, tandem affinity purification association, genetic 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Western physical 12644583 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID HSPB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct HSPD1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HSPH1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HUWE1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, tandem affinity purification association, physical 16269333 , 17314511 , 18488021 , 26279298 , (Europe PMC )0.35 BioGRID, IntAct IDH3A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IDH3B Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IDH3G Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IGF2BP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IGF2BP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct IGF2BP3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct IGF2R Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID IKBKG Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 20970423 , (Europe PMC )0.46 BioGRID, IntAct, MINT ILVBL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ING4 Protein-RNA physical 23603392 , (Europe PMC )NA BioGRID IPO13 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IPO4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IPO7 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IPO9 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IQGAP2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IQGAP3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IRAK1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IRS2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID IRS4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ITGB5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID JUN Affinity Capture-Western, tandem affinity purification association, physical 20232342 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct KAT2A Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 10611234 , 12660246 , 16287840 , 17967894 , 20691906 , (Europe PMC )NA BioGRID KAT2B Biochemical Activity physical 15572685 , (Europe PMC )NA BioGRID KAT5 Affinity Capture-Western, Reconstituted Complex physical 12776177 , 18003922 , 20946988 , (Europe PMC )NA BioGRID KCTD2 Affinity Capture-Western physical 28060381 , (Europe PMC )NA BioGRID KDM1A Two-hybrid, two hybrid physical, physical association 23455924 , (Europe PMC )0.37 BioGRID, IntAct, MINT KDM5B Affinity Capture-Western physical 22371483 , (Europe PMC )NA BioGRID KIDINS220 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct KIF18A Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID KNDC1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID KPNA2 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array association, physical, physical association 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct KPNA4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct KPNB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct LATS1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID LDOC1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct LGALS1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct LIMK2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID LMNA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct LMTK3 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID LONP1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID LRPPRC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct LRRC59 Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID MAP2K1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAP2K3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MAP2K7 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MAP3K13 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MAP3K20 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MAPK1 Reconstituted Complex physical 15210690 , 7957875 , (Europe PMC )NA BioGRID MAPK3 Reconstituted Complex physical 15210690 , (Europe PMC )NA BioGRID MAPK8 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 10551811 , (Europe PMC )NA BioGRID MARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct MATK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MAX Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, FRET, Reconstituted Complex, Two-hybrid physical 10229200 , 10319872 , 10465786 , 10593926 , 10611234 , 10918583 , 12391307 , 12553908 , 12584560 , 12660246 , 12821782 , 12824180 , 14749374 , 15572685 , 16140957 , 16287840 , 16352593 , 16596619 , 16705173 , 17289033 , 17314511 , 17353931 , 17418410 , 17471507 , 17643117 , 17700062 , 18003922 , 19578763 , 19623651 , 2006410 , 20382893 , 20936779 , 20946988 , 21150319 , 21988832 , 23816886 , 25522242 , 25609649 , 26496610 , 8224841 , 9184233 , 9528857 , 9680483 , 9708738 , (Europe PMC )NA BioGRID MCAT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MCL1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MCM7 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.73 BioGRID, IntAct MCU Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MED1 Reconstituted Complex physical 17967894 , (Europe PMC )NA BioGRID MED16 Reconstituted Complex physical 17967894 , (Europe PMC )NA BioGRID MEN1 Affinity Capture-Western, Reconstituted Complex physical 19818711 , (Europe PMC )NA BioGRID METTL13 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct METTL3 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MICALL2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MIPEP Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MKLN1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MLH1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12584560 , (Europe PMC )NA BioGRID MLH3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MMS19 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID MNT Affinity Capture-Western physical 18271930 , (Europe PMC )NA BioGRID MOGS Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MRPL53 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MRPL58 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MRPS22 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MRPS34 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH2 Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 12584560 , 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH6 Affinity Capture-MS physical 17314511 , 17353931 , (Europe PMC )NA BioGRID MYBBP1A Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 20848231 , 21150319 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYCBP Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 12223483 , 9797456 , (Europe PMC )0.37 BioGRID, IntAct MYCBP2 Affinity Capture-Western, Far Western physical 26517351 , 9689053 , (Europe PMC )NA BioGRID MYCN Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYLK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MYLK3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MYO1B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MYO3B Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MYO5C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYO9A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYO9B Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MZT2B Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NABP2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NCBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NCOR1 Synthetic Lethality, tandem affinity purification association, genetic 21150319 , 22157079 , (Europe PMC )0.35 BioGRID, IntAct NDRG1 Affinity Capture-Western physical 28456659 , (Europe PMC )NA BioGRID NDUFA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFA8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFAF3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NDUFB10 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID NDUFS1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFS2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NDUFS3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NECAB3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEIL1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEK11 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID NEK2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEK9 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NFE2L2 Affinity Capture-Western physical 20232342 , 22942279 , (Europe PMC )NA BioGRID NFYB Affinity Capture-Western, Reconstituted Complex physical 11282029 , (Europe PMC )NA BioGRID NFYC Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10446203 , (Europe PMC )NA BioGRID NLRX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NMI Affinity Capture-Western, Reconstituted Complex, Two-hybrid, beta galactosidase complementation physical, physical association 10597290 , 11916966 , (Europe PMC )0.37 BioGRID, IntAct NONO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NOP56 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NOTCH3 Reconstituted Complex physical 25356737 , (Europe PMC )NA BioGRID NQO2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NR1H3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NRXN3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NTRK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NUCB1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NUP133 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NUP153 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NUP205 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NUP93 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct OAT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct OPA1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct P3H1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID P4HA1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PACSIN1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PAK2 Affinity Capture-Western, Biochemical Activity physical 14749374 , 16081735 , (Europe PMC )NA BioGRID PAK6 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PARP10 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15674325 , 22992334 , (Europe PMC )NA BioGRID PBK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PCBD1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PCBP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PDCD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PDLIM7 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PDS5A Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PDZD2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PELO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PES1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PFDN5 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 11567024 , 11585818 , 11844794 , 17728244 , 22844532 , 9792694 , (Europe PMC )0.35 BioGRID, IntAct PHKG2 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID PHLDB2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PI4KB Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PIAS2 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical, physical association 17418410 , 17471507 , (Europe PMC )0.50 BioGRID, IntAct PIM1 Affinity Capture-Western physical 17643117 , (Europe PMC )NA BioGRID PIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, nuclear magnetic resonance, surface plasmon resonance association, direct interaction, physical 15048125 , 19131971 , 26655473 , (Europe PMC )0.71 BioGRID, IntAct, MINT PKN1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PKP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PLAU Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PLIN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLK1 Affinity Capture-MS, Biochemical Activity, tandem affinity purification association, physical 17314511 , 27773673 , (Europe PMC )0.35 BioGRID, IntAct PLOD3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PML Affinity Capture-Western, Reconstituted Complex, tandem affinity purification association, physical 15735755 , 17146439 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct PNO1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLA1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID POLD1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct POLE Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct POLH Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-MS, chromatin immunoprecipitation assay, tandem affinity purification association, physical 17314511 , 23079660 , (Europe PMC )0.53 BioGRID, IntAct POLR2B Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct POLR2E Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID POLR2I Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 17632056 , 19131971 , 25438055 , (Europe PMC )0.46 BioGRID, IntAct, MINT PPP2R5A Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19131971 , (Europe PMC )0.35 BioGRID, IntAct, MINT PPP6C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PPT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PRC1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PRDX1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PRKCD Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID PRKDC Affinity Capture-MS, Synthetic Lethality, tandem affinity purification association, genetic, physical 17314511 , 25495526 , (Europe PMC )0.35 BioGRID, IntAct PRPF6 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct PRPF8 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PSKH2 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID PSMA1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct PSMA2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PSMA4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA7 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMC2 Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 17314511 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct PSMC3 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct PSMC4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMC5 Affinity Capture-Western physical 12963825 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMD2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PSMD3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSME4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PTGES2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PTP4A2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PTPN14 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PTPN9 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID QPCTL Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RAB11FIP5 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RAD21 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RAF1 Affinity Capture-MS, Reconstituted Complex, tandem affinity purification association, physical 17314511 , 9315742 , (Europe PMC )0.35 BioGRID, IntAct RANBP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RARS Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RASGRF1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RASSF7 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RB1 Two-hybrid physical 7838535 , (Europe PMC )NA BioGRID RBL1 Affinity Capture-Western physical 8076603 , (Europe PMC )NA BioGRID RBM15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RBMS2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RBPJ Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RCN1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RCOR3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RELA Affinity Capture-Western physical 12027803 , 15616592 , (Europe PMC )NA BioGRID REV1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RFC2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFC3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFC4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct RFC5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RHOBTB1 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID RIF1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID RIMS2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RIN3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RIOX1 Affinity Capture-Western physical 17308053 , (Europe PMC )NA BioGRID RNF115 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 22844532 , (Europe PMC )NA BioGRID RNF130 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID RNF4 Reconstituted Complex physical 27653698 , (Europe PMC )NA BioGRID RNGTT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RNH1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ROBO2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RPL11 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17599065 , (Europe PMC )0.40 BioGRID, IntAct, MINT RPL13 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RPN1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RPN2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RPP30 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct RPS27L Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID RUNX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RUVBL1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, tandem affinity purification association, physical 11509179 , 11839798 , 17314511 , (Europe PMC )0.35 BioGRID, IntAct RUVBL2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, tandem affinity purification association, physical 11839798 , 12660246 , 17314511 , 20509972 , (Europe PMC )0.35 BioGRID, IntAct SAE1 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID SAP130 Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID SARS Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SCO2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SCYL1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SDC4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SDF4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 21150319 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct SDK1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID SEC31B Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SENP2 Biochemical Activity physical 25895136 , (Europe PMC )NA BioGRID SERPINH1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SF3B1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct SH3BP4 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SH3KBP1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SHOC2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SIRT1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, deacetylase assay direct interaction, physical, physical association 21807113 , 22190494 , (Europe PMC )0.60 BioGRID, IntAct SKP1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, tandem affinity purification, two hybrid array association, physical, physical association 12963825 , 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct SKP2 Affinity Capture-Western, PCA, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12769844 , 12963825 , 17157259 , 23277542 , 24259667 , 26038816 , (Europe PMC )0.40 BioGRID, IntAct SLC1A4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SLC25A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A11 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A12 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A13 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A26 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SLC25A3 Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID SLC39A10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLIT2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SMAD2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11804592 , (Europe PMC )NA BioGRID SMAD3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11804592 , (Europe PMC )NA BioGRID SMAD7 Affinity Capture-Western physical 24259667 , (Europe PMC )NA BioGRID SMARCA2 Reconstituted Complex physical 14559996 , (Europe PMC )NA BioGRID SMARCA4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11839798 , 14559996 , 17353931 , (Europe PMC )0.40 BioGRID, IntAct SMARCA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct SMARCB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10319872 , 14559996 , (Europe PMC )NA BioGRID SMARCC1 Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 14559996 , 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct SMC2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct SMC4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct SMTN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SNIP1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 17157259 , (Europe PMC )0.63 BioGRID, IntAct SNRNP200 Affinity Capture-MS, Dosage Lethality, anti bait coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 17314511 , 17353931 , 22623531 , (Europe PMC )0.56 BioGRID, IntAct SNRNP70 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SNRPC Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID SNW1 Affinity Capture-Western physical 19818711 , (Europe PMC )NA BioGRID SP1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 11274368 , 15780936 , 17418410 , 18003922 , (Europe PMC )0.50 BioGRID, IntAct SPEG Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct SPTLC1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SQOR Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID SQSTM1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SRP9 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSBP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSR1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSR4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct STUB1 Affinity Capture-Western, Reconstituted Complex physical 22543587 , 28128329 , (Europe PMC )NA BioGRID SUCLG1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID SULF2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SULT1A2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SUPT3H Affinity Capture-Western, Reconstituted Complex physical 12660246 , 17967894 , (Europe PMC )NA BioGRID SUV39H1 Dosage Lethality, tandem affinity purification association, genetic 22623531 , 27705803 , (Europe PMC )0.35 BioGRID, IntAct TADA2A Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID TAF1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TAF12 Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID TAF9 Affinity Capture-Western, Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID TARSL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TBP Reconstituted Complex physical 8755740 , (Europe PMC )NA BioGRID TCF12 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TCP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TDG Affinity Capture-MS, tandem affinity purification association, physical 21150319 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct TF Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TFAM Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TFAP2A Affinity Capture-Western, Reconstituted Complex physical 7729426 , (Europe PMC )NA BioGRID TFAP2C Affinity Capture-Western, Co-localization, Phenotypic Enhancement genetic, physical 22371483 , (Europe PMC )NA BioGRID TIAM1 Affinity Capture-Western, Reconstituted Complex physical 12446731 , (Europe PMC )NA BioGRID TIE1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TKT Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TMEM161A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMPO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TONSL Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TOP1 Affinity Capture-MS, display technology, tandem affinity purification association, physical, physical association 17314511 , 20195357 , (Europe PMC )0.56 BioGRID, IntAct TOP2A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TP53 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TP73 Affinity Capture-Western, Reconstituted Complex physical 11844794 , 12080043 , (Europe PMC )NA BioGRID TRIB1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TRIM21 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct TRIM6 Affinity Capture-Western, Two-hybrid physical 22328504 , (Europe PMC )NA BioGRID TRIO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIP12 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical, physical association 20208519 , (Europe PMC )0.63 BioGRID, IntAct TRIP13 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TRMT1L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TRPC4AP Affinity Capture-Western physical 20551172 , 26038816 , (Europe PMC )NA BioGRID TRRAP Affinity Capture-MS, Affinity Capture-Western, Co-localization, Dosage Lethality, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 10611234 , 11511539 , 11839798 , 12660246 , 16705173 , 17314511 , 17353931 , 19818711 , 20946988 , 21150319 , 22623531 , 9708738 , (Europe PMC )0.79 BioGRID, IntAct TSN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TTC27 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TTC5 Affinity Capture-Western physical 23559008 , (Europe PMC )NA BioGRID TUBA1A Affinity Capture-Western physical 20691906 , (Europe PMC )NA BioGRID TUBA4A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct TUBB Affinity Capture-Western physical 20691906 , (Europe PMC )NA BioGRID TUBG1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TUBGCP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TUT4 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID TXK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TXN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct U2SURP Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct UBA2 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID UBE2I Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID UBE2L3 Affinity Capture-Western physical 11431533 , (Europe PMC )NA BioGRID UBE2O Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID UBE3C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct UBR2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct USP2 Biochemical Activity physical 25895136 , (Europe PMC )NA BioGRID USP22 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 18206973 , 28160502 , (Europe PMC )NA BioGRID USP28 Affinity Capture-Western, Biochemical Activity physical 17558397 , 17873522 , 23389829 , 25716680 , (Europe PMC )NA BioGRID USP33 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID USP36 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 25775507 , (Europe PMC )NA BioGRID USP37 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 25284584 , (Europe PMC )NA BioGRID USP7 Affinity Capture-Western, Reconstituted Complex physical 27618649 , (Europe PMC )NA BioGRID VDR Affinity Capture-Western physical 23112173 , (Europe PMC )NA BioGRID VHL Affinity Capture-Western physical 22286234 , (Europe PMC )NA BioGRID WDR5 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17353931 , 27320920 , (Europe PMC )0.40 BioGRID, IntAct WDR77 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct WEE1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID WEE2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID WNK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-Western physical 26894970 , (Europe PMC )NA BioGRID XDH Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct XPO1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 26673895 , (Europe PMC )0.35 BioGRID, IntAct XPO5 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct XPOT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct XRCC5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct XRCC6 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , (Europe PMC )0.46 BioGRID, IntAct XRN1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct XYLT1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct YBX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct YEATS4 Affinity Capture-MS, Reconstituted Complex physical 22068108 , 26186194 , 28514442 , (Europe PMC )NA BioGRID YES1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct YWHAE Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct YWHAQ Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct YY1 Reconstituted Complex, Two-hybrid physical 8266081 , (Europe PMC )NA BioGRID ZBTB17 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 11283613 , 16352593 , 17418410 , 18923429 , 19786833 , 20426839 , 26766587 , 9312026 , (Europe PMC )0.78 BioGRID, IntAct, MINT ZFYVE21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZNF121 Affinity Capture-MS, tandem affinity purification, two hybrid association, physical, physical association 17314511 , (Europe PMC )0.48 BioGRID, IntAct ZNF281 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ABCA9 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ABCB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ABCB7 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ABRA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ACACA anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ACACB tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ACOT8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ACTC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ACTG1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ACTL6A Affinity Capture-MS, Affinity Capture-Western, Co-purification, tandem affinity purification association, physical 11839798 , 17314511 , 25609649 , (Europe PMC )0.53 BioGRID, IntAct, MINT ACTL8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAMTS20 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ADAR Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADIPOR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ADNP Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AFAP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AGK tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AGPAT1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AHNAK tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AHNAK2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AIFM2 Dosage Lethality, tandem affinity purification association, genetic 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct AJAP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AKAP8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct AKAP8L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDH18A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDH1B1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALPK3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AMBRA1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 25438055 , (Europe PMC )0.40 BioGRID, IntAct AMOTL2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ANLN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ANXA2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AP2A1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct AP3D1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct AP4B1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARCN1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ARF1 anti bait coimmunoprecipitation physical association 17289033 , (Europe PMC )0.40 IntAct, MINT ARF4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ARFGAP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARG1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARHGEF2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct ARID4B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARID5B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARL1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ARMC6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ARSB tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ASPM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ASS1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ATAD3B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATP1A1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ATP2A2 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct ATP5F1C tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct ATP5J2 tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct ATP5O tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATP6V1D tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATP6V1H anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ATXN10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AXIN1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, direct interaction, physical, physical association 19131971 , (Europe PMC )0.62 BioGRID, IntAct, MINT B4GALT7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BAHCC1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BCO1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BCR Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct BICRA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BIN1 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, two hybrid direct interaction, physical, physical association 10380878 , 15992821 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT BPTF tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BRD3 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct BRPF1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct BRWD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BTAF1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BUB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct C1QBP Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct C2orf16 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct C4A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CACNA1G tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CALCOCO2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CALD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CAMK2D Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct CAVIN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CAVIN3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CBFB Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CCAR2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , 22190494 , (Europe PMC )0.75 BioGRID, IntAct CCM2L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CCT2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT6A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CDC26 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDC42EP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDCA7L Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation physical, physical association 15994933 , 16829576 , (Europe PMC )0.40 BioGRID, IntAct CDK1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct CDK4 Biochemical Activity, Two-hybrid, protein kinase assay, two hybrid array phosphorylation reaction, physical, physical association 21988832 , 22094256 , (Europe PMC )0.59 BioGRID, IntAct CDK5RAP2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDK6 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22094256 , (Europe PMC )0.44 BioGRID, IntAct CDV3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDYL tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEBPZ anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CENPF Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CENPV tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEP170 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEP55 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEP57 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct CEPT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CFL1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CHAF1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CHCHD3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CHD4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , (Europe PMC )0.50 BioGRID, IntAct CHD5 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CHD9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHTF18 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 21575199 , (Europe PMC )0.46 BioGRID, IntAct CIP2A anti tag coimmunoprecipitation, pull down direct interaction, physical association 17632056 , (Europe PMC )0.54 IntAct CKAP4 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CLEC11A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CLSTN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNMD tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNOT11 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNOT4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNTN5 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct COPB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct COPG1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct COPG2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CPSF1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CPSF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CROCC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CSE1L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CSF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CSMD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CSPP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CTBP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CTNND1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CTPS1 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17353931 , 21150319 , (Europe PMC )0.56 IntAct CTR9 Affinity Capture-Western, tandem affinity purification association, physical 21150319 , 26687678 , (Europe PMC )0.35 BioGRID, IntAct CYBA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CYC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CYP2U1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CYR61 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DACT1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DCLK1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct DCTN1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DDX1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DDX17 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct DDX20 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct DDX24 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct DDX3X tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct DDX47 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DDX51 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DDX52 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DENND3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DENND6B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DHX15 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DHX37 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DHX58 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DIAPH3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DIMT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DIP2B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DIRAS2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DNAAF5 {ECO:0000303|PubMed:25232951, anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DNAJA2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNAJA3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNAJB11 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct DNAJB12 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DNAJB6 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNM2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DOCK7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DPM1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct DSP anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DUSP15 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DYNC1H1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DYNC1LI1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DYNLRB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EBI-1058428 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058461 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058587 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058623 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058683 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058689 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058844 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058847 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058859 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1648030 pull down association, physical association 17728244 , (Europe PMC )0.50 IntAct EBI-1648054 pull down association 17728244 , (Europe PMC )0.35 IntAct EBI-3962679 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EBI-4399559 pull down physical association 18413597 , (Europe PMC )0.40 IntAct ECSIT Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ECT2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EEF1G Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct EFNB1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct EFTUD2 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.68 BioGRID, IntAct EHHADH tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EIF3E tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct EIF3I tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct EIF4A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct EIF4ENIF1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ELFN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ELMSAN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ELP1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ENSG00000003402 chromatin immunoprecipitation assay association 22266862 , (Europe PMC )0.35 IntAct ENSG00000012048 chromatin immunoprecipitation assay association 21668996 , (Europe PMC )0.35 IntAct ENSG00000084774 chromatin immunoprecipitation assay association 17157259 , 24951594 , (Europe PMC )0.53 IntAct ENSG00000089009 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000100316 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000114315 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000115053 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000124762 chromatin immunoprecipitation assay association 15084259 , (Europe PMC )0.35 IntAct ENSG00000125691 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000134057 chromatin immunoprecipitation assay association 17157259 , (Europe PMC )0.35 IntAct ENSG00000134333 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000134419 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000135446 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000145545 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000177606 chromatin immunoprecipitation assay association 22266862 , (Europe PMC )0.35 IntAct EP300 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15616592 , 16126174 , 16287840 , 17157259 , (Europe PMC )0.40 BioGRID, IntAct EP400 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11509179 , 17314511 , 18413597 , 20946988 , 21150319 , (Europe PMC )0.40, 0.67 BioGRID, IntAct EPC1 Affinity Capture-MS, tandem affinity purification association, physical 20946988 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct EPPK1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ERBIN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ERC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ERCC3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ERP44 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ETFA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ETV3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ETV6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EU154351.1 chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct EU154353.1 chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct EXOC1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EXOC3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EXOC4 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct EXOSC1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EZH2 chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct FAF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FAM117B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FAM122B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FANCD2 Affinity Capture-MS, Co-localization, tandem affinity purification association, physical 17314511 , 24658369 , (Europe PMC )0.35 BioGRID, IntAct FANCI Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct FANCM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FASTKD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FASTKD2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FBL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct FBXW7 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 17157259 , 17314511 , 23791182 , (Europe PMC )0.67 IntAct FBXW8 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 17314511 , (Europe PMC )0.57 BioGRID, IntAct FERMT3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FHL2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FLNA Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOSL1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOSL2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FOXC2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FOXO3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 18393360 , (Europe PMC )0.52 IntAct FOXO6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOXR1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXR2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT FRMD6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FRMPD4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FZR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GABRR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GANAB Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct GCDH Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GCN1 tandem affinity purification, two hybrid pooling approach association, physical association 17314511 , 20936779 , (Europe PMC )0.55 IntAct GEMIN4 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GFPT1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GIGYF2 {ECO:0000303|PubMed:12771153, display technology physical association 20195357 , (Europe PMC )0.40 IntAct GLUD2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct GNL3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct GPR158 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GPX2 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GSK3B Affinity Capture-Western, Split renilla luciferase complementation, Synthetic Lethality, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 14563837 , 19131971 , 20713710 , 21150319 , 25495526 , (Europe PMC )0.37, 0.60 BioGRID, IntAct, MINT GTF2I Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, tandem affinity purification association, physical 17314511 , 8377829 , (Europe PMC )0.35 BioGRID, IntAct GTF3C1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GTF3C2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GTF3C3 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct GTF3C4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct H2AFZ tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct H3F3A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HADHA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HADHB Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 21150319 , 26496610 , (Europe PMC )0.64 BioGRID, IntAct HASPIN tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct HCFC2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HDAC1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 18003922 , 18271930 , 22286234 , 24951594 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct HDAC2 Affinity Capture-MS, Affinity Capture-Western, display technology, tandem affinity purification association, physical, physical association 17314511 , 20195357 , 22286234 , (Europe PMC )0.56 BioGRID, IntAct HDAC3 Affinity Capture-Western, anti bait coimmunoprecipitation, chromatin immunoprecipitation assay association, physical 18483244 , 22002311 , 23079660 , (Europe PMC )0.46 BioGRID, IntAct HEATR1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HEATR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct HELLS anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct HIGD1A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HIRA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H1A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H2AB tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H2BL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HIST1H2BM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H4A chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct HK1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HNRNPA0 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct HNRNPF Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPK Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HOXA10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HOXB5 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HSD17B4 Dosage Lethality, tandem affinity purification association, genetic 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct HSPA8 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HSPB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct HSPD1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HSPH1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HUWE1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, tandem affinity purification association, physical 16269333 , 17314511 , 18488021 , 26279298 , (Europe PMC )0.35 BioGRID, IntAct ICA1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct IDH3A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IDH3B Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IDH3G Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IGF2BP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IGF2BP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct IGF2BP3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct IK tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IKBKG Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 20970423 , (Europe PMC )0.46 BioGRID, IntAct, MINT IKZF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IL16 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IL1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IL4R tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ILVBL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IMMT tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct INSM1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IPO11 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct IPO13 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IPO4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IPO7 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IPO9 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IQCE tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IQGAP1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct IQGAP2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IQGAP3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IRAK1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IRS4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ITGAL tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct JUN Affinity Capture-Western, tandem affinity purification association, physical 20232342 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct KALRN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KANK2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KARS tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KCNG3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KDM1A Two-hybrid, two hybrid physical, physical association 23455924 , (Europe PMC )0.37 BioGRID, IntAct, MINT KIAA0319 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIAA2026 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIDINS220 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct KIF12 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIF20B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIF25 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KLF10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KLHL5 display technology physical association 20195357 , (Europe PMC )0.40 IntAct KMT2A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KNDC1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KPNA2 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array association, physical, physical association 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct KPNA4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct KPNB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct LAS1L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct LATS1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct LBR anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct LBX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LCN12 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LDOC1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct LGALS1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct LGALS7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LIMS1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LMNA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct LMO7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LONP1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct LOX tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LRP1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LRPPRC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct MAATS1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAGEB10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAGED2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MAGI1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP1A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP2K1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAP3K1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP3K20 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MAP3K5 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP3K7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP7D1 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17353931 , 21150319 , (Europe PMC )0.56 IntAct MAPKAP1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct MARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct MAST4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MATN4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MATR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MAX anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, nuclear magnetic resonance, proximity ligation assay, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach association, direct interaction, physical association 12821782 , 16352593 , 16606833 , 17157259 , 17314511 , 17353931 , 17418410 , 18620061 , 20691906 , 20936779 , 21150319 , 21807113 , 21988832 , 24951594 , 25609649 , 26267534 , 26496610 , 27705803 , 9680483 , (Europe PMC )0.35, 0.98 IntAct, MINT MBD3 anti tag coimmunoprecipitation association, physical association 24048479 , (Europe PMC )0.50 IntAct MCAT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MCF2L2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MCM3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MCM4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MCM7 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.73 BioGRID, IntAct MCTP2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MCU anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MDN1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MED12L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct METTL13 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct METTL3 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MFGE8 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MFHAS1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MIB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MICALL2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MIPEP Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MKL1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MKLN1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MLH3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MMS19 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct MOGS Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MRGBP tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MRPL14 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MRPL53 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MRPS22 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MRPS34 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH2 Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 12584560 , 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH6 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct MTHFD1L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MTRF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MUC3A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MUC5AC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYBBP1A Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 20848231 , 21150319 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYCBP Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 12223483 , 9797456 , (Europe PMC )0.37 BioGRID, IntAct MYCN Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYO18A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYO1B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MYO1D tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYO5A anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MYO5C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYO9A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYO9B Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MZT2B Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NABP2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NAIP tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NAP1L1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NAV2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NAV3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NCAPD3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NCAPG2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NCBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NCOR1 Synthetic Lethality, tandem affinity purification association, genetic 21150319 , 22157079 , (Europe PMC )0.35 BioGRID, IntAct NCOR2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NDUFA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFA8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFAF3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NDUFS1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFS2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NDUFS3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NEK11 two hybrid array physical association 21988832 , (Europe PMC )0.37 IntAct NEK9 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NFIL3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NLRX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NMI Affinity Capture-Western, Reconstituted Complex, Two-hybrid, beta galactosidase complementation physical, physical association 10597290 , 11916966 , (Europe PMC )0.37 BioGRID, IntAct NOC2L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NOL11 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NOL9 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NOMO3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NONO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NOP56 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NPC1L1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NPR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NPTX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NRDC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NRXN3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NUCB1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NUP133 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NUP153 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NUP188 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NUP205 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NUP93 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct NUP98 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct OAT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct OBSCN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct OPA1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct OPHN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct OTUD4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct P3H1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct P4HA1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PADI2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PALD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PCBP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PCBP2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PDCD11 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PDCD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDHA2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PDLIM4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PDLIM7 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PDS5A anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PDS5B anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17353931 , 21150319 , (Europe PMC )0.56 IntAct PDZD2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PELO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PFDN2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PFDN5 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 11567024 , 11585818 , 11844794 , 17728244 , 22844532 , 9792694 , (Europe PMC )0.35 BioGRID, IntAct PGAP1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PGD tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PHF20 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PHF6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PHLDB2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PIAS2 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical, physical association 17418410 , 17471507 , (Europe PMC )0.50 BioGRID, IntAct PIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, nuclear magnetic resonance, surface plasmon resonance association, direct interaction, physical 15048125 , 19131971 , 26655473 , (Europe PMC )0.71 BioGRID, IntAct, MINT PITX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PKM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PKP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PLA2G4A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PLAU Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PLEKHH1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PLIN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLK1 Affinity Capture-MS, Biochemical Activity, tandem affinity purification association, physical 17314511 , 27773673 , (Europe PMC )0.35 BioGRID, IntAct PLOD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PLOD3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PML Affinity Capture-Western, Reconstituted Complex, tandem affinity purification association, physical 15735755 , 17146439 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct PNO1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLD1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct POLE Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct POLG tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct POLR2A Affinity Capture-MS, chromatin immunoprecipitation assay, tandem affinity purification association, physical 17314511 , 23079660 , (Europe PMC )0.53 BioGRID, IntAct POLR2B Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct POLR3A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct POP4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPA2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPIP5K2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPP1CA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PPP1R15A display technology physical association 20195357 , (Europe PMC )0.40 IntAct PPP1R2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct PPP2CA Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 17632056 , 19131971 , 25438055 , (Europe PMC )0.46 BioGRID, IntAct, MINT PPP2R3B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPP2R5A Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19131971 , (Europe PMC )0.35 BioGRID, IntAct, MINT PPP6C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PPT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PRDX1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PREX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRG4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRKAR1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRKDC Affinity Capture-MS, Synthetic Lethality, tandem affinity purification association, genetic, physical 17314511 , 25495526 , (Europe PMC )0.35 BioGRID, IntAct PRPF6 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct PRPF8 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRR11 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRRC2A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PSMA1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct PSMA2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PSMA4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA7 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMC1 tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct PSMC2 Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 17314511 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct PSMC3 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct PSMC4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMC6 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMD2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PSMD3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMD4 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct PSME4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PTBP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PTGES2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PTPN14 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct QPCTL Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RAB11FIP5 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RAD50 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RAF1 Affinity Capture-MS, Reconstituted Complex, tandem affinity purification association, physical 17314511 , 9315742 , (Europe PMC )0.35 BioGRID, IntAct RAG1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RALGAPA1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RANBP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RARS Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RBFA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBFOX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBM10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBM15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RBM39 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBMS2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RBPJ Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RCN1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RCOR3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RFC1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RFC2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFC3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFC4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct RFC5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFX7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RIF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RIMS2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RIN3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RNF130 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RNGTT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RNH1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ROBO2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RPL11 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17599065 , (Europe PMC )0.40 BioGRID, IntAct, MINT RPL13 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RPL26L1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPN1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RPN2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RPP30 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct RPRD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS16 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS21 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS27L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RRM1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RRP1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RUNX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RUNX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RUVBL1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, tandem affinity purification association, physical 11509179 , 11839798 , 17314511 , (Europe PMC )0.35 BioGRID, IntAct RUVBL2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, tandem affinity purification association, physical 11839798 , 12660246 , 17314511 , 20509972 , (Europe PMC )0.35 BioGRID, IntAct SACS tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SAMD9L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SARS Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SBNO2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SCD display technology physical association 20195357 , (Europe PMC )0.40 IntAct SCO2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SDF2L1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SDF4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 21150319 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct SDHA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SDK1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SEC11C tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SEC31B Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SEC61A1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct SERPINH1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SET display technology physical association 20195357 , (Europe PMC )0.40 IntAct SETX tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SF3B1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct SGO2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SH3BP4 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SH3RF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SHANK2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SHE tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SHOC2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SIN3B anti bait coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, proximity ligation assay association, colocalization, physical association 24951594 , (Europe PMC )0.63 IntAct SIPA1L3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SIRT1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, deacetylase assay direct interaction, physical, physical association 21807113 , 22190494 , (Europe PMC )0.60 BioGRID, IntAct SIRT2 anti tag coimmunoprecipitation physical association 23217706 , (Europe PMC )0.40 IntAct SIRT5 anti tag coimmunoprecipitation physical association 23217706 , (Europe PMC )0.40 IntAct SIRT6 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 23217706 , (Europe PMC )0.52 IntAct SKIV2L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SKP1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, tandem affinity purification, two hybrid array association, physical, physical association 12963825 , 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct SKP2 Affinity Capture-Western, PCA, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12769844 , 12963825 , 17157259 , 23277542 , 24259667 , 26038816 , (Europe PMC )0.40 BioGRID, IntAct SLC25A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SLC25A11 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A12 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A13 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC39A10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLIT2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SMARCA4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11839798 , 14559996 , 17353931 , (Europe PMC )0.40 BioGRID, IntAct SMARCA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct SMARCAD1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMARCC1 Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 14559996 , 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct SMARCC2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMC1A anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMC2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct SMC3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMC4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct SMC6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SMTN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SMYD4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SNIP1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 17157259 , (Europe PMC )0.63 BioGRID, IntAct SNRNP200 Affinity Capture-MS, Dosage Lethality, anti bait coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 17314511 , 17353931 , 22623531 , (Europe PMC )0.56 BioGRID, IntAct SNRNP70 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SNRPD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SNRPF tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SNX19 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SORBS1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SP1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 11274368 , 15780936 , 17418410 , 18003922 , (Europe PMC )0.50 BioGRID, IntAct SPATA31E1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SPEG Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct SPTLC1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SQOR tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct SQSTM1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SRP14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SRP9 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSBP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSR1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSR4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ST6GALNAC6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct STAG2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SUCLG1 tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct SUCLG2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SUV39H1 Dosage Lethality, tandem affinity purification association, genetic 22623531 , 27705803 , (Europe PMC )0.35 BioGRID, IntAct SUZ12 anti bait coimmunoprecipitation, chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.46 IntAct SYNE1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TAF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TARSL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TBL2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TCF12 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TCP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TDG Affinity Capture-MS, tandem affinity purification association, physical 21150319 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct TENM2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TEX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TF Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TFAM Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TKT Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TMEM131L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TMEM161A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMEM33 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TMPO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TMPRSS11A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNFRSF18 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNPO1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNPO3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TNR tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNS2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TONSL Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TOP1 Affinity Capture-MS, display technology, tandem affinity purification association, physical, physical association 17314511 , 20195357 , (Europe PMC )0.56 BioGRID, IntAct TOP2A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TP53 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TP53BP1 display technology, proximity-dependent biotin identification association, physical association 20195357 , 29656893 , (Europe PMC )0.56 IntAct TPH1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TPP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRABD2A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRAK1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRAP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRIM21 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TRIM28 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct TRIO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIP12 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical, physical association 20208519 , (Europe PMC )0.63 BioGRID, IntAct TRMT1L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TRPM1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRRAP Affinity Capture-MS, Affinity Capture-Western, Co-localization, Dosage Lethality, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 10611234 , 11511539 , 11839798 , 12660246 , 16705173 , 17314511 , 17353931 , 19818711 , 20946988 , 21150319 , 22623531 , 9708738 , (Europe PMC )0.79 BioGRID, IntAct TSN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TTC27 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TTN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TUBA4A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct TUBB3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TUBB6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TUBG1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TUBGCP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TUBGCP4 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TUFM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TXN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct U2SURP Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct UBA1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct UBC anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 16996503 , 19131971 , 21150319 , (Europe PMC )0.69 IntAct, MINT UBE3C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct UBR2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct UBTF display technology, tandem affinity purification association, physical association 20195357 , 21150319 , (Europe PMC )0.56 IntAct UNC45A anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct UQCRFS1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct USP10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct USP36 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct USP48 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct USP9X anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct UST display technology physical association 20195357 , (Europe PMC )0.40 IntAct UTP15 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct WDFY3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct WDR5 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17353931 , 27320920 , (Europe PMC )0.40 BioGRID, IntAct WDR77 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct WIPF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct XDH Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct XKRX tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct XPO1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 26673895 , (Europe PMC )0.35 BioGRID, IntAct XPO5 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct XPO7 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct XPOT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct XRCC5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct XRCC6 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , (Europe PMC )0.46 BioGRID, IntAct XRN1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct XYLT1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct YAF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct YBX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct YWHAB Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct YWHAE Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct YWHAQ Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ZBTB17 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 11283613 , 16352593 , 17418410 , 18923429 , 19786833 , 20426839 , 26766587 , 9312026 , (Europe PMC )0.78 BioGRID, IntAct, MINT ZBTB18 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZC3H18 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZC3H7B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZCCHC11 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZFHX3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZFYVE21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZNF106 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZNF121 Affinity Capture-MS, tandem affinity purification, two hybrid association, physical, physical association 17314511 , (Europe PMC )0.48 BioGRID, IntAct ZNF281 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ZNF354B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZNF541 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZNF586 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZNF703 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZNF740 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ZZEF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARF1 anti bait coimmunoprecipitation physical association 17289033 , (Europe PMC )0.40 IntAct, MINT AXIN1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, direct interaction, physical, physical association 19131971 , (Europe PMC )0.62 BioGRID, IntAct, MINT BIN1 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, two hybrid direct interaction, physical, physical association 10380878 , 15992821 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT FOXO6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXR1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXR2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT GSK3B Affinity Capture-Western, Split renilla luciferase complementation, Synthetic Lethality, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 14563837 , 19131971 , 20713710 , 21150319 , 25495526 , (Europe PMC )0.37, 0.60 BioGRID, IntAct, MINT IKBKG Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 20970423 , (Europe PMC )0.46 BioGRID, IntAct, MINT KDM1A Two-hybrid, two hybrid physical, physical association 23455924 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAX anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, nuclear magnetic resonance, proximity ligation assay, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach association, direct interaction, physical association 12821782 , 16352593 , 16606833 , 17157259 , 17314511 , 17353931 , 17418410 , 18620061 , 20691906 , 20936779 , 21150319 , 21807113 , 21988832 , 24951594 , 25609649 , 26267534 , 26496610 , 27705803 , 9680483 , (Europe PMC )0.35, 0.98 IntAct, MINT MYC Affinity Capture-MS, tandem affinity purification association, physical 20848231 , 21150319 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYCN Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, nuclear magnetic resonance, surface plasmon resonance association, direct interaction, physical 15048125 , 19131971 , 26655473 , (Europe PMC )0.71 BioGRID, IntAct, MINT PKP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PPP2CA Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 17632056 , 19131971 , 25438055 , (Europe PMC )0.46 BioGRID, IntAct, MINT PPP2R5A Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19131971 , (Europe PMC )0.35 BioGRID, IntAct, MINT RPL11 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17599065 , (Europe PMC )0.40 BioGRID, IntAct, MINT UBC anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 16996503 , 19131971 , 21150319 , (Europe PMC )0.69 IntAct, MINT ZBTB17 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 11283613 , 16352593 , 17418410 , 18923429 , 19786833 , 20426839 , 26766587 , 9312026 , (Europe PMC )0.78 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ABCA9 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ABCB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ABCB7 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ABRA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ACACA anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ACACB tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ACOT8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ACTB Co-purification physical 11839798 , (Europe PMC )NA BioGRID ACTC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ACTG1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ACTL6A Affinity Capture-MS, Affinity Capture-Western, Co-purification, tandem affinity purification association, physical 11839798 , 17314511 , 25609649 , (Europe PMC )0.53 BioGRID, IntAct, MINT ACTL8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADAMTS20 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ADAR Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ADIPOR1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID ADIPOR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ADNP Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AFAP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AGK tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AGPAT1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AHNAK tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AHNAK2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AIFM2 Dosage Lethality, tandem affinity purification association, genetic 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct AJAP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AKAP6 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID AKAP8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct AKAP8L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDH18A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDH1B1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ALDOA Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID ALPK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID ALPK3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct AMBRA1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 25438055 , (Europe PMC )0.40 BioGRID, IntAct AMOTL2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ANGPTL4 Co-purification physical 22573825 , (Europe PMC )NA BioGRID ANLN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ANXA2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct AP2A1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct AP3D1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct AP4B1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct APP Reconstituted Complex physical 21244100 , (Europe PMC )NA BioGRID ARCN1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ARF1 anti bait coimmunoprecipitation physical association 17289033 , (Europe PMC )0.40 IntAct, MINT ARF4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ARFGAP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARFGEF2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID ARG1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARHGEF2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct ARID4B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARID5B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ARL1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ARMC6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ARSB tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ASPM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ASS1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID ASS1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ATAD2 Affinity Capture-Western, Reconstituted Complex physical 19843847 , (Europe PMC )NA BioGRID ATAD3B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATP1A1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ATP2A2 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct ATP5F1C Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID ATP5F1C tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct ATP5F1D Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID ATP5J2 tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct ATP5MF Affinity Capture-MS physical 17314511 , 21150319 , (Europe PMC )NA BioGRID ATP5O tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATP6V1D tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ATP6V1H anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ATXN10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AXIN1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, direct interaction, physical, physical association 19131971 , (Europe PMC )0.62 BioGRID, IntAct, MINT B4GALT7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BAHCC1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BCL2 Affinity Capture-Western, Co-localization physical 15210690 , (Europe PMC )NA BioGRID BCO1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BCR Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct BICRA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BIN1 Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, two hybrid direct interaction, physical, physical association 10380878 , 15992821 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT BLM Affinity Capture-Western, Reconstituted Complex physical 23750012 , (Europe PMC )NA BioGRID BMPR1A Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BNIP2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BOK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BPTF tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BRCA1 Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid physical 11916966 , 12646176 , 14612409 , 20215511 , 9788437 , (Europe PMC )NA BioGRID BRD3 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct BRD4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BRD8 Affinity Capture-MS physical 20946988 , (Europe PMC )NA BioGRID BRPF1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID BRPF1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct BRWD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct BTAF1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BTK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western, Biochemical Activity physical 20852628 , (Europe PMC )NA BioGRID BUB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct C17orf49 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID C1QBP Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct C2orf16 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct C4A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CACNA1G tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CALCOCO2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CALD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CALM1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CAMK1G Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CAMK2D Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct CAMK2G Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CARM1 Affinity Capture-Western physical 15616592 , (Europe PMC )NA BioGRID CAVIN1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CAVIN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CAVIN3 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CAVIN3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CBFB Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CCAR2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , 22190494 , (Europe PMC )0.75 BioGRID, IntAct CCM2L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CCNH Reconstituted Complex physical 11673469 , (Europe PMC )NA BioGRID CCNK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CCNT1 Affinity Capture-Western, Reconstituted Complex physical 11673469 , 12944920 , 17700062 , 19818711 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT6A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CCT8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CD6 Affinity Capture-Western physical 10899308 , (Europe PMC )NA BioGRID CDC26 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDC42EP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDC6 Reconstituted Complex physical 10899308 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-Western, Protein-peptide physical 26687678 , (Europe PMC )NA BioGRID CDCA7L Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation physical, physical association 15994933 , 16829576 , (Europe PMC )0.40 BioGRID, IntAct CDH5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CDK1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct CDK12 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CDK16 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID CDK2 Dosage Lethality, Synthetic Lethality genetic 22623531 , 25495526 , (Europe PMC )NA BioGRID CDK4 Biochemical Activity, Two-hybrid, protein kinase assay, two hybrid array phosphorylation reaction, physical, physical association 21988832 , 22094256 , (Europe PMC )0.59 BioGRID, IntAct CDK5RAP2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDK6 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22094256 , (Europe PMC )0.44 BioGRID, IntAct CDK8 Reconstituted Complex physical 11673469 , (Europe PMC )NA BioGRID CDK9 Affinity Capture-Western, Reconstituted Complex physical 11673469 , 12944920 , 17700062 , 19818711 , 26687678 , (Europe PMC )NA BioGRID CDKN1B Affinity Capture-Western, PCA physical 26701207 , (Europe PMC )NA BioGRID CDKN2A Affinity Capture-Western physical 17289033 , 20308430 , 23277542 , (Europe PMC )NA BioGRID CDR2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10465786 , 20383333 , (Europe PMC )NA BioGRID CDV3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CDYL Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CDYL tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEBPA Affinity Capture-Western physical 12873812 , (Europe PMC )NA BioGRID CEBPB Affinity Capture-Western physical 12873812 , (Europe PMC )NA BioGRID CEBPZ anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CECR2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CENPF Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CENPO Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CENPV tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEP170 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEP55 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CEP57 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct CEPT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CFL1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CHAF1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CHCHD3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CHD4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , (Europe PMC )0.50 BioGRID, IntAct CHD5 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CHD9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHTF18 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 21575199 , (Europe PMC )0.46 BioGRID, IntAct CIP2A Affinity Capture-Western, Reconstituted Complex physical 17632056 , (Europe PMC )NA BioGRID CIP2A anti tag coimmunoprecipitation, pull down direct interaction, physical association 17632056 , (Europe PMC )0.54 IntAct CKAP4 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CLEC11A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CLSTN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNMD Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID CNMD tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNOT11 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNOT4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CNTN5 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct COPB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct COPG1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct COPG2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CPS1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CPSF1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CPSF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CRADD Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 12776737 , 16878156 , (Europe PMC )NA BioGRID CROCC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CSE1L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct CSF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CSMD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CSNK1E Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CSNK2A1 Biochemical Activity physical 12149649 , (Europe PMC )NA BioGRID CSPP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CTBP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CTNND1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CTPS1 Affinity Capture-MS, Dosage Lethality genetic, physical 21150319 , 22623531 , (Europe PMC )NA BioGRID CTPS1 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17353931 , 21150319 , (Europe PMC )0.56 IntAct CTR9 Affinity Capture-Western, tandem affinity purification association, physical 21150319 , 26687678 , (Europe PMC )0.35 BioGRID, IntAct CTSD Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western physical 12769844 , (Europe PMC )NA BioGRID CUL4A Affinity Capture-Western physical 20551172 , (Europe PMC )NA BioGRID CXXC1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID CYBA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CYC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct CYP2U1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct CYR61 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DACT1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DCAF8 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID DCLK1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct DCTN1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DDB1 Affinity Capture-Western physical 20551172 , (Europe PMC )NA BioGRID DDB2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID DDX1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DDX17 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct DDX20 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct DDX24 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct DDX3X tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct DDX47 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DDX51 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DDX52 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DENND3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DENND6B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DHX15 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DHX37 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DHX58 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DIAPH3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DIMT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DIP2B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DIRAS2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DMAP1 Affinity Capture-Western physical 20946988 , (Europe PMC )NA BioGRID DNAAF5 {ECO:0000303|PubMed:25232951, anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DNAJA2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNAJA3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNAJB11 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct DNAJB12 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID DNAJB12 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DNAJB6 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DNM2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DNMT3A Affinity Capture-Western, Reconstituted Complex physical 15616584 , 19786833 , (Europe PMC )NA BioGRID DOCK7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DPM1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct DSP anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct DUSP15 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DYNC1H1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct DYNC1LI1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct DYNLRB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EBI-1058428 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058461 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058587 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058623 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058683 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058689 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058844 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058847 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1058859 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1648030 pull down association, physical association 17728244 , (Europe PMC )0.50 IntAct EBI-1648054 pull down association 17728244 , (Europe PMC )0.35 IntAct EBI-3962679 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EBI-4399559 pull down physical association 18413597 , (Europe PMC )0.40 IntAct ECSIT Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ECT2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EEF1G Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct EFNA5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID EFNB1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct EFTUD2 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.68 BioGRID, IntAct EHHADH tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EIF3E tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct EIF3I Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID EIF3I tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct EIF4A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct EIF4ENIF1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELF3 Biochemical Activity physical 1651323 , (Europe PMC )NA BioGRID ELFN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ELMSAN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ELP1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID ELP1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct ENSG00000003402 chromatin immunoprecipitation assay association 22266862 , (Europe PMC )0.35 IntAct ENSG00000012048 chromatin immunoprecipitation assay association 21668996 , (Europe PMC )0.35 IntAct ENSG00000084774 chromatin immunoprecipitation assay association 17157259 , 24951594 , (Europe PMC )0.53 IntAct ENSG00000089009 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000100316 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000114315 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000115053 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000124762 chromatin immunoprecipitation assay association 15084259 , (Europe PMC )0.35 IntAct ENSG00000125691 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000134057 chromatin immunoprecipitation assay association 17157259 , (Europe PMC )0.35 IntAct ENSG00000134333 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000134419 chromatin immunoprecipitation assay association 23217706 , (Europe PMC )0.35 IntAct ENSG00000135446 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000145545 chromatin immunoprecipitation assay association 24951594 , (Europe PMC )0.35 IntAct ENSG00000177606 chromatin immunoprecipitation assay association 22266862 , (Europe PMC )0.35 IntAct EP300 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15616592 , 16126174 , 16287840 , 17157259 , (Europe PMC )0.40 BioGRID, IntAct EP400 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11509179 , 17314511 , 18413597 , 20946988 , 21150319 , (Europe PMC )0.40, 0.67 BioGRID, IntAct EPC1 Affinity Capture-MS, tandem affinity purification association, physical 20946988 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct EPC2 Affinity Capture-MS physical 20946988 , (Europe PMC )NA BioGRID EPPK1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ERBIN Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID ERBIN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ERC1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ERCC3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ERN1 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID ERP44 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ESR1 Affinity Capture-Western physical 16455494 , (Europe PMC )NA BioGRID ETFA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ETV3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct ETV6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EU154351.1 chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct EU154353.1 chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct EXOC1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EXOC3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EXOC4 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct EXOSC1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct EYA1 Affinity Capture-Western, Biochemical Activity physical 27795300 , (Europe PMC )NA BioGRID EZH2 chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct FAF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FAM117B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FAM122B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FAM131C Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID FANCD2 Affinity Capture-MS, Co-localization, tandem affinity purification association, physical 17314511 , 24658369 , (Europe PMC )0.35 BioGRID, IntAct FANCI Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct FANCM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FASTKD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FASTKD2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FBL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct FBXO5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID FBXO8 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 20848231 , (Europe PMC )NA BioGRID FBXW7 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 15103331 , 15150404 , 15498494 , 17157259 , 17314511 , 17646408 , 17873522 , 20848231 , 20970423 , 22524983 , 23750012 , 25716680 , 25720964 , 27795300 , 28007894 , 28209614 , (Europe PMC )NA BioGRID FBXW7 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 17157259 , 17314511 , 23791182 , (Europe PMC )0.67 IntAct FBXW8 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 17314511 , (Europe PMC )0.57 BioGRID, IntAct FERMT3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FHL2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FLNA Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOSL1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOSL2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FOXC2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FOXO3 Affinity Capture-Western physical 18393360 , (Europe PMC )NA BioGRID FOXO3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 18393360 , (Europe PMC )0.52 IntAct FOXO6 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct FOXR1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXR2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , 26186194 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT FRMD6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FRMPD4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct FZR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GABRR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GALR3 Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID GANAB Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct GCDH Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GCHFR Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID GCN1 Affinity Capture-MS, Two-hybrid physical 17314511 , 17353931 , 20936779 , (Europe PMC )NA BioGRID GCN1 tandem affinity purification, two hybrid pooling approach association, physical association 17314511 , 20936779 , (Europe PMC )0.55 IntAct GEMIN4 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GFPT1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GIGYF2 {ECO:0000303|PubMed:12771153, display technology physical association 20195357 , (Europe PMC )0.40 IntAct GLI1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GLUD2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct GNL3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct GNRHR Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GPR158 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct GPX2 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GRK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GRK3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GSK3A Affinity Capture-Western, Reconstituted Complex physical 14563837 , (Europe PMC )NA BioGRID GSK3B Affinity Capture-Western, Split renilla luciferase complementation, Synthetic Lethality, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 14563837 , 19131971 , 20713710 , 21150319 , 25495526 , (Europe PMC )0.37, 0.60 BioGRID, IntAct, MINT GTF2F1 Reconstituted Complex physical 8755740 , (Europe PMC )NA BioGRID GTF2H4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID GTF2I Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, tandem affinity purification association, physical 17314511 , 8377829 , (Europe PMC )0.35 BioGRID, IntAct GTF3C1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GTF3C2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct GTF3C3 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct GTF3C4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct H2AFZ tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct H3F3A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HADHA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HADHB Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 21150319 , 26496610 , (Europe PMC )0.64 BioGRID, IntAct HASPIN Affinity Capture-MS, Dosage Lethality genetic, physical 17314511 , 22623531 , (Europe PMC )NA BioGRID HASPIN tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct HAUS7 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HBP1 Affinity Capture-Western, Two-hybrid physical 20008325 , (Europe PMC )NA BioGRID HCFC2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HCK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HDAC1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 18003922 , 18271930 , 22286234 , 24951594 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct HDAC2 Affinity Capture-MS, Affinity Capture-Western, display technology, tandem affinity purification association, physical, physical association 17314511 , 20195357 , 22286234 , (Europe PMC )0.56 BioGRID, IntAct HDAC3 Affinity Capture-Western, anti bait coimmunoprecipitation, chromatin immunoprecipitation assay association, physical 18483244 , 22002311 , 23079660 , (Europe PMC )0.46 BioGRID, IntAct HEATR1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HEATR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct HECTD3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HELLS Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID HELLS anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct HELZ Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western physical 15071503 , (Europe PMC )NA BioGRID HIGD1A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HIRA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H1A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H2AB tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H2BL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HIST1H2BM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HIST1H4A chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.35 IntAct HK1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HNRNPA0 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct HNRNPD Protein-RNA physical 23603392 , (Europe PMC )NA BioGRID HNRNPF Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPK Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HNRNPU Affinity Capture-Western physical 19578763 , (Europe PMC )NA BioGRID HOXA10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HOXB5 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HPS1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID HSD17B4 Dosage Lethality, tandem affinity purification association, genetic 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Western physical 12644583 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID HSPA8 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct HSPB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct HSPD1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HSPH1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct HUWE1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, tandem affinity purification association, physical 16269333 , 17314511 , 18488021 , 26279298 , (Europe PMC )0.35 BioGRID, IntAct ICA1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct IDH3A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IDH3B Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IDH3G Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IGF2BP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IGF2BP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct IGF2BP3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct IGF2R Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID IK tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IKBKG Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 20970423 , (Europe PMC )0.46 BioGRID, IntAct, MINT IKZF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IL16 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IL1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IL4R tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ILVBL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IMMT tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ING4 Protein-RNA physical 23603392 , (Europe PMC )NA BioGRID INSM1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IPO11 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct IPO13 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IPO4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IPO7 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IPO9 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IQCE tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct IQGAP1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct IQGAP2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct IQGAP3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IRAK1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct IRS2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID IRS4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ITGAL tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct ITGB5 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID JUN Affinity Capture-Western, tandem affinity purification association, physical 20232342 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct KALRN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KANK2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KARS tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KAT2A Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 10611234 , 12660246 , 16287840 , 17967894 , 20691906 , (Europe PMC )NA BioGRID KAT2B Biochemical Activity physical 15572685 , (Europe PMC )NA BioGRID KAT5 Affinity Capture-Western, Reconstituted Complex physical 12776177 , 18003922 , 20946988 , (Europe PMC )NA BioGRID KCNG3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KCTD2 Affinity Capture-Western physical 28060381 , (Europe PMC )NA BioGRID KDM1A Two-hybrid, two hybrid physical, physical association 23455924 , (Europe PMC )0.37 BioGRID, IntAct, MINT KDM5B Affinity Capture-Western physical 22371483 , (Europe PMC )NA BioGRID KIAA0319 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIAA2026 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIDINS220 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct KIF12 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIF18A Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID KIF20B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KIF25 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KLF10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KLHL5 display technology physical association 20195357 , (Europe PMC )0.40 IntAct KMT2A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KNDC1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID KNDC1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct KPNA2 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array association, physical, physical association 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct KPNA4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct KPNB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct LAS1L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct LATS1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID LATS1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct LBR anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct LBX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LCN12 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LDOC1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct LGALS1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct LGALS7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LIMK2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID LIMS1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LMNA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct LMO7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LMTK3 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID LONP1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID LONP1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct LOX tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LRP1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct LRPPRC Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct LRRC59 Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID MAATS1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAGEB10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAGED2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MAGI1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP1A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP2K1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAP2K3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MAP2K7 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MAP3K1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP3K13 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MAP3K20 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MAP3K20 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MAP3K5 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP3K7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MAP7D1 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17353931 , 21150319 , (Europe PMC )0.56 IntAct MAPK1 Reconstituted Complex physical 15210690 , 7957875 , (Europe PMC )NA BioGRID MAPK3 Reconstituted Complex physical 15210690 , (Europe PMC )NA BioGRID MAPK8 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 10551811 , (Europe PMC )NA BioGRID MAPKAP1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct MARS Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct MAST4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MATK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MATN4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MATR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MAX Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, FRET, Reconstituted Complex, Two-hybrid physical 10229200 , 10319872 , 10465786 , 10593926 , 10611234 , 10918583 , 12391307 , 12553908 , 12584560 , 12660246 , 12821782 , 12824180 , 14749374 , 15572685 , 16140957 , 16287840 , 16352593 , 16596619 , 16705173 , 17289033 , 17314511 , 17353931 , 17418410 , 17471507 , 17643117 , 17700062 , 18003922 , 19578763 , 19623651 , 2006410 , 20382893 , 20936779 , 20946988 , 21150319 , 21988832 , 23816886 , 25522242 , 25609649 , 26496610 , 8224841 , 9184233 , 9528857 , 9680483 , 9708738 , (Europe PMC )NA BioGRID MAX anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, nuclear magnetic resonance, proximity ligation assay, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach association, direct interaction, physical association 12821782 , 16352593 , 16606833 , 17157259 , 17314511 , 17353931 , 17418410 , 18620061 , 20691906 , 20936779 , 21150319 , 21807113 , 21988832 , 24951594 , 25609649 , 26267534 , 26496610 , 27705803 , 9680483 , (Europe PMC )0.35, 0.98 IntAct, MINT MBD3 anti tag coimmunoprecipitation association, physical association 24048479 , (Europe PMC )0.50 IntAct MCAT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MCF2L2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MCL1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MCM3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MCM4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MCM7 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.73 BioGRID, IntAct MCTP2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MCU Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MCU anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MDN1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MED1 Reconstituted Complex physical 17967894 , (Europe PMC )NA BioGRID MED12L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MED16 Reconstituted Complex physical 17967894 , (Europe PMC )NA BioGRID MEN1 Affinity Capture-Western, Reconstituted Complex physical 19818711 , (Europe PMC )NA BioGRID METTL13 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct METTL3 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID METTL3 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MFGE8 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MFHAS1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MIB1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MICALL2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MIPEP Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MKL1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MKLN1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MLH1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12584560 , (Europe PMC )NA BioGRID MLH3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MMS19 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID MMS19 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct MNT Affinity Capture-Western physical 18271930 , (Europe PMC )NA BioGRID MOGS Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MRGBP tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MRPL14 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MRPL53 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct MRPL58 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MRPS22 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MRPS34 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH2 Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 12584560 , 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MSH6 Affinity Capture-MS physical 17314511 , 17353931 , (Europe PMC )NA BioGRID MSH6 anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17314511 , 17353931 , (Europe PMC )0.56 IntAct MTHFD1L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MTRF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MUC3A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MUC5AC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYBBP1A Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 20848231 , 21150319 , 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYCBP Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 12223483 , 9797456 , (Europe PMC )0.37 BioGRID, IntAct MYCBP2 Affinity Capture-Western, Far Western physical 26517351 , 9689053 , (Europe PMC )NA BioGRID MYCN Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MYLK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MYLK3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MYO18A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYO1B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MYO1D tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct MYO3B Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID MYO5A anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MYO5C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYO9A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYO9B Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MZT2B Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NABP2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NAIP tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NAP1L1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NAV2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NAV3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NCAPD3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NCAPG2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NCBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCL Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NCOR1 Synthetic Lethality, tandem affinity purification association, genetic 21150319 , 22157079 , (Europe PMC )0.35 BioGRID, IntAct NCOR2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NDRG1 Affinity Capture-Western physical 28456659 , (Europe PMC )NA BioGRID NDUFA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFA8 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFAF3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NDUFB10 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID NDUFS1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NDUFS2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NDUFS3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NECAB3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEIL1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEK11 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID NEK11 two hybrid array physical association 21988832 , (Europe PMC )0.37 IntAct NEK2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEK9 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NFE2L2 Affinity Capture-Western physical 20232342 , 22942279 , (Europe PMC )NA BioGRID NFIL3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NFYB Affinity Capture-Western, Reconstituted Complex physical 11282029 , (Europe PMC )NA BioGRID NFYC Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10446203 , (Europe PMC )NA BioGRID NLRX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NMI Affinity Capture-Western, Reconstituted Complex, Two-hybrid, beta galactosidase complementation physical, physical association 10597290 , 11916966 , (Europe PMC )0.37 BioGRID, IntAct NOC2L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NOL11 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NOL9 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NOMO3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NONO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NOP56 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NOTCH3 Reconstituted Complex physical 25356737 , (Europe PMC )NA BioGRID NPC1L1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NPR1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NPTX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NQO2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NR1H3 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NRDC tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct NRXN3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct NTRK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NUCB1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NUP133 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct NUP153 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct NUP188 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct NUP205 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NUP93 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct NUP98 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct OAT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct OBSCN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct OPA1 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct OPHN1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct OTUD4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct P3H1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID P3H1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct P4HA1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PACSIN1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PADI2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PAK2 Affinity Capture-Western, Biochemical Activity physical 14749374 , 16081735 , (Europe PMC )NA BioGRID PAK6 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PALD1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PARP10 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15674325 , 22992334 , (Europe PMC )NA BioGRID PBK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PCBD1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PCBP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PCBP2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PDCD11 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PDCD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDHA2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PDK1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PDLIM4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PDLIM7 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PDS5A Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PDS5A anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PDS5B anti bait coimmunoprecipitation, tandem affinity purification association, physical association 17353931 , 21150319 , (Europe PMC )0.56 IntAct PDZD2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PELO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PES1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PFDN2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PFDN5 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 11567024 , 11585818 , 11844794 , 17728244 , 22844532 , 9792694 , (Europe PMC )0.35 BioGRID, IntAct PGAP1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PGD tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PHF20 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PHF6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PHKG2 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID PHLDB2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct PI4KB Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PIAS2 Affinity Capture-Western, anti bait coimmunoprecipitation association, physical, physical association 17418410 , 17471507 , (Europe PMC )0.50 BioGRID, IntAct PIM1 Affinity Capture-Western physical 17643117 , (Europe PMC )NA BioGRID PIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, nuclear magnetic resonance, surface plasmon resonance association, direct interaction, physical 15048125 , 19131971 , 26655473 , (Europe PMC )0.71 BioGRID, IntAct, MINT PITX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PKM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PKN1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PKP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT PLA2G4A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PLAU Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PLEKHH1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PLIN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLK1 Affinity Capture-MS, Biochemical Activity, tandem affinity purification association, physical 17314511 , 27773673 , (Europe PMC )0.35 BioGRID, IntAct PLOD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PLOD3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PML Affinity Capture-Western, Reconstituted Complex, tandem affinity purification association, physical 15735755 , 17146439 , 21150319 , (Europe PMC )0.35 BioGRID, IntAct PNO1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct POLA1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID POLD1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct POLE Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct POLG tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct POLH Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-MS, chromatin immunoprecipitation assay, tandem affinity purification association, physical 17314511 , 23079660 , (Europe PMC )0.53 BioGRID, IntAct POLR2B Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct POLR2E Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID POLR2I Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID POLR3A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct POP4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPA2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPIP5K2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPP1CA Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PPP1R15A display technology physical association 20195357 , (Europe PMC )0.40 IntAct PPP1R2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct PPP2CA Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 17632056 , 19131971 , 25438055 , (Europe PMC )0.46 BioGRID, IntAct, MINT PPP2R3B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PPP2R5A Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 19131971 , (Europe PMC )0.35 BioGRID, IntAct, MINT PPP6C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PPT1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PRC1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PRDX1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PREX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRG4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRKAR1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRKCD Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID PRKDC Affinity Capture-MS, Synthetic Lethality, tandem affinity purification association, genetic, physical 17314511 , 25495526 , (Europe PMC )0.35 BioGRID, IntAct PRPF6 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct PRPF8 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRR11 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PRRC2A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PSKH2 Synthetic Lethality genetic 25495526 , (Europe PMC )NA BioGRID PSMA1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17314511 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct PSMA2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PSMA4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMA7 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMB5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMC1 tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct PSMC2 Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 17314511 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct PSMC3 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid association, physical, physical association 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct PSMC4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMC5 Affinity Capture-Western physical 12963825 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMD2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PSMD3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PSMD4 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct PSME4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PTBP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct PTGES2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct PTP4A2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID PTPN14 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct PTPN9 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID QPCTL Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RAB11FIP5 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RAD21 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RAD50 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RAF1 Affinity Capture-MS, Reconstituted Complex, tandem affinity purification association, physical 17314511 , 9315742 , (Europe PMC )0.35 BioGRID, IntAct RAG1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RALGAPA1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RANBP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RARS Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RASGRF1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RASSF7 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RB1 Two-hybrid physical 7838535 , (Europe PMC )NA BioGRID RBFA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBFOX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBL1 Affinity Capture-Western physical 8076603 , (Europe PMC )NA BioGRID RBM10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBM15 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RBM39 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RBMS2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RBPJ Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RCN1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RCOR3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RELA Affinity Capture-Western physical 12027803 , 15616592 , (Europe PMC )NA BioGRID REV1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID RFC1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RFC2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFC3 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFC4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17353931 , 21150319 , (Europe PMC )0.56 BioGRID, IntAct RFC5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RFX7 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RHOBTB1 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID RIF1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID RIF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RIMS2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RIN3 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RIOX1 Affinity Capture-Western physical 17308053 , (Europe PMC )NA BioGRID RNF115 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 22844532 , (Europe PMC )NA BioGRID RNF130 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID RNF130 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RNF4 Reconstituted Complex physical 27653698 , (Europe PMC )NA BioGRID RNGTT Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RNH1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ROBO2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RPL11 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17599065 , (Europe PMC )0.40 BioGRID, IntAct, MINT RPL13 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RPL26L1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPN1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RPN2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct RPP30 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct RPRD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS16 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS21 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RPS27L Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID RPS27L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RRM1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RRP1B tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RUNX1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct RUNX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct RUVBL1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, tandem affinity purification association, physical 11509179 , 11839798 , 17314511 , (Europe PMC )0.35 BioGRID, IntAct RUVBL2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, tandem affinity purification association, physical 11839798 , 12660246 , 17314511 , 20509972 , (Europe PMC )0.35 BioGRID, IntAct SACS tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SAE1 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID SAMD9L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SAP130 Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID SARS Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SBNO2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SCD display technology physical association 20195357 , (Europe PMC )0.40 IntAct SCO2 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SCYL1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SDC4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SDF2L1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SDF4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 21150319 , 26496610 , (Europe PMC )0.53 BioGRID, IntAct SDHA tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SDK1 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID SDK1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SEC11C tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SEC31B Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SEC61A1 tandem affinity purification association 17314511 , (Europe PMC )0.35 IntAct SENP2 Biochemical Activity physical 25895136 , (Europe PMC )NA BioGRID SERPINH1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SET display technology physical association 20195357 , (Europe PMC )0.40 IntAct SETX tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SF3B1 Two-hybrid, two hybrid pooling approach physical, physical association 20936779 , (Europe PMC )0.37 BioGRID, IntAct SGO2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SH3BP4 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SH3KBP1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SH3RF1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SHANK2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SHE tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SHOC2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SIN3B anti bait coimmunoprecipitation, chromatin immunoprecipitation assay, confocal microscopy, proximity ligation assay association, colocalization, physical association 24951594 , (Europe PMC )0.63 IntAct SIPA1L3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SIRT1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, deacetylase assay direct interaction, physical, physical association 21807113 , 22190494 , (Europe PMC )0.60 BioGRID, IntAct SIRT2 anti tag coimmunoprecipitation physical association 23217706 , (Europe PMC )0.40 IntAct SIRT5 anti tag coimmunoprecipitation physical association 23217706 , (Europe PMC )0.40 IntAct SIRT6 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical association 23217706 , (Europe PMC )0.52 IntAct SKIV2L anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SKP1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, tandem affinity purification, two hybrid array association, physical, physical association 12963825 , 17314511 , 21988832 , (Europe PMC )0.55 BioGRID, IntAct SKP2 Affinity Capture-Western, PCA, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12769844 , 12963825 , 17157259 , 23277542 , 24259667 , 26038816 , (Europe PMC )0.40 BioGRID, IntAct SLC1A4 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SLC25A1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A10 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SLC25A11 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A12 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A13 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SLC25A26 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SLC25A3 Affinity Capture-MS physical 20848231 , (Europe PMC )NA BioGRID SLC39A10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLIT2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SMAD2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11804592 , (Europe PMC )NA BioGRID SMAD3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11804592 , (Europe PMC )NA BioGRID SMAD7 Affinity Capture-Western physical 24259667 , (Europe PMC )NA BioGRID SMARCA2 Reconstituted Complex physical 14559996 , (Europe PMC )NA BioGRID SMARCA4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11839798 , 14559996 , 17353931 , (Europe PMC )0.40 BioGRID, IntAct SMARCA5 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct SMARCAD1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMARCB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10319872 , 14559996 , (Europe PMC )NA BioGRID SMARCC1 Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 14559996 , 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct SMARCC2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMC1A anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMC2 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct SMC3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMC4 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , 21150319 , (Europe PMC )0.67 BioGRID, IntAct SMC6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SMTN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SMYD4 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SNIP1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid physical, physical association 17157259 , (Europe PMC )0.63 BioGRID, IntAct SNRNP200 Affinity Capture-MS, Dosage Lethality, anti bait coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 17314511 , 17353931 , 22623531 , (Europe PMC )0.56 BioGRID, IntAct SNRNP70 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SNRPC Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID SNRPD2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SNRPF tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SNW1 Affinity Capture-Western physical 19818711 , (Europe PMC )NA BioGRID SNX19 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SORBS1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SP1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 11274368 , 15780936 , 17418410 , 18003922 , (Europe PMC )0.50 BioGRID, IntAct SPATA31E1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SPEG Affinity Capture-MS, Dosage Lethality, tandem affinity purification association, genetic, physical 21150319 , 22623531 , (Europe PMC )0.35 BioGRID, IntAct SPTLC1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SQOR Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID SQOR tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct SQSTM1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct SRP14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SRP9 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSBP1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSR1 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct SSR4 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct ST6GALNAC6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct STAG2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct STUB1 Affinity Capture-Western, Reconstituted Complex physical 22543587 , 28128329 , (Europe PMC )NA BioGRID SUCLG1 Affinity Capture-MS physical 17314511 , (Europe PMC )NA BioGRID SUCLG1 tandem affinity purification association 17314511 , 21150319 , (Europe PMC )0.53 IntAct SUCLG2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct SULF2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SULT1A2 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID SUPT3H Affinity Capture-Western, Reconstituted Complex physical 12660246 , 17967894 , (Europe PMC )NA BioGRID SUV39H1 Dosage Lethality, tandem affinity purification association, genetic 22623531 , 27705803 , (Europe PMC )0.35 BioGRID, IntAct SUZ12 anti bait coimmunoprecipitation, chromatin immunoprecipitation assay association 23079660 , (Europe PMC )0.46 IntAct SYNE1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TADA2A Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID TAF1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID TAF12 Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID TAF2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TAF9 Affinity Capture-Western, Reconstituted Complex physical 12660246 , (Europe PMC )NA BioGRID TARSL2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TBL2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TBP Reconstituted Complex physical 8755740 , (Europe PMC )NA BioGRID TCF12 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TCP1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TDG Affinity Capture-MS, tandem affinity purification association, physical 21150319 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct TENM2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TEX2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TF Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TFAM Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TFAP2A Affinity Capture-Western, Reconstituted Complex physical 7729426 , (Europe PMC )NA BioGRID TFAP2C Affinity Capture-Western, Co-localization, Phenotypic Enhancement genetic, physical 22371483 , (Europe PMC )NA BioGRID TIAM1 Affinity Capture-Western, Reconstituted Complex physical 12446731 , (Europe PMC )NA BioGRID TIE1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TKT Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TMEM131L tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TMEM161A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TMEM33 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TMPO Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TMPRSS11A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNFRSF18 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNPO1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNPO3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TNR tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TNS2 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TONSL Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TOP1 Affinity Capture-MS, display technology, tandem affinity purification association, physical, physical association 17314511 , 20195357 , (Europe PMC )0.56 BioGRID, IntAct TOP2A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TP53 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TP53BP1 display technology, proximity-dependent biotin identification association, physical association 20195357 , 29656893 , (Europe PMC )0.56 IntAct TP73 Affinity Capture-Western, Reconstituted Complex physical 11844794 , 12080043 , (Europe PMC )NA BioGRID TPH1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TPP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRABD2A tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRAK1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRAP1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRIB1 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TRIM21 Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification association, physical, physical association 17314511 , 17353931 , (Europe PMC )0.56 BioGRID, IntAct TRIM6 Affinity Capture-Western, Two-hybrid physical 22328504 , (Europe PMC )NA BioGRID TRIO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIP12 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical, physical association 20208519 , (Europe PMC )0.63 BioGRID, IntAct TRIP13 Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TRMT1L Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TRPC4AP Affinity Capture-Western physical 20551172 , 26038816 , (Europe PMC )NA BioGRID TRPM1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TRRAP Affinity Capture-MS, Affinity Capture-Western, Co-localization, Dosage Lethality, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, tandem affinity purification association, genetic, physical, physical association 10611234 , 11511539 , 11839798 , 12660246 , 16705173 , 17314511 , 17353931 , 19818711 , 20946988 , 21150319 , 22623531 , 9708738 , (Europe PMC )0.79 BioGRID, IntAct TSN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct TTC27 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TTC5 Affinity Capture-Western physical 23559008 , (Europe PMC )NA BioGRID TTN tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TUBA1A Affinity Capture-Western physical 20691906 , (Europe PMC )NA BioGRID TUBA4A Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct TUBB Affinity Capture-Western physical 20691906 , (Europe PMC )NA BioGRID TUBB3 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TUBB6 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TUBG1 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TUBGCP2 Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct TUBGCP4 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TUFM tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct TUT4 Affinity Capture-MS physical 21150319 , (Europe PMC )NA BioGRID TXK Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID TXN Affinity Capture-MS, tandem affinity purification association, physical 21150319 , (Europe PMC )0.35 BioGRID, IntAct U2SURP Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct UBA1 tandem affinity purification association 21150319 , (Europe PMC )0.35 IntAct UBA2 Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID UBC anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical association 16996503 , 19131971 , 21150319 , (Europe PMC )0.69 IntAct, MINT UBE2I Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID UBE2L3 Affinity Capture-Western physical 11431533 , (Europe PMC )NA BioGRID UBE2O Synthetic Lethality genetic 22157079 , (Europe PMC )NA BioGRID UBE3C Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Eur