- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
BCAR1
Gene Name  | BCAR1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 5O2M |
| Synonyms | BCAR1, CAS, CASS1, CRKAS | |
| Protein Name | BCAR1 | |
| Alternative Name(s) | Breast cancer anti-estrogen resistance protein 1;CRK-associated substrate;Cas scaffolding protein family member 1;p130cas; | |
| Protein Family | Belongs to the CAS family | |
| EntrezGene ID | 9564 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P56945 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 93372 Dalton | |
| Protein Length | 870 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000050820 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - ENOG410IEDD | eggNOG - ENOG410ZSUM | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cell junction, focal adhesion Cytoplasm Note=Unphosphorylated formlocalizes in the cytoplasm and can move to the membrane upontyrosine phosphorylation | |||
| Function (UniProt annotation) | |||
| Docking protein which plays a central coordinating rolefor tyrosine kinase-based signaling related to cell adhesionImplicated in induction of cell migration Overexpression confersantiestrogen resistance on breast cancer cells | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPA TPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSP ATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGP LLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVA DGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL AGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQ ALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSP PKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLS RQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001558 | P:regulation of cell growth |
| GO:0001726 | C:ruffle |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005925 | C:focal adhesion |
| GO:0007015 | P:actin filament organization |
| GO:0007155 | P:cell adhesion |
| GO:0007173 | P:epidermal growth factor receptor signaling pathway |
| GO:0007186 | P:G-protein coupled receptor signaling pathway |
| GO:0007229 | P:integrin-mediated signaling pathway |
| GO:0008283 | P:cell proliferation |
| GO:0008286 | P:insulin receptor signaling pathway |
| GO:0010595 | P:positive regulation of endothelial cell migration |
| GO:0015629 | C:actin cytoskeleton |
| GO:0016477 | P:cell migration |
| GO:0017124 | F:SH3 domain binding |
| GO:0019901 | F:protein kinase binding |
| GO:0030027 | C:lamellipodium |
| GO:0030335 | P:positive regulation of cell migration |
| GO:0035729 | P:cellular response to hepatocyte growth factor stimulus |
| GO:0042981 | P:regulation of apoptotic process |
| GO:0048008 | P:platelet-derived growth factor receptor signaling pathway |
| GO:0048010 | P:vascular endothelial growth factor receptor signaling pathway |
| GO:0048011 | P:neurotrophin TRK receptor signaling pathway |
| GO:0048012 | P:hepatocyte growth factor receptor signaling pathway |
| GO:0050851 | P:antigen receptor-mediated signaling pathway |
| GO:0050852 | P:T cell receptor signaling pathway |
| GO:0050853 | P:B cell receptor signaling pathway |
| GO:0051301 | P:cell division |
| GO:0060326 | P:cell chemotaxis |
BCAR1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in BCAR1 (P56945) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTPN12 | Q05209 | NA | In vitro and in vivo | 9285683, 12714323, 9748319, 8887669, 9920935, | Europe PMC |  |
| PTPRA | P18433 | NA | In vitro and in vivo | 10787408, | Europe PMC | |
| PTPRH | Q9HD43 | NA | In vitro and in vivo | 11278335, | Europe PMC | |
| PPP2CA | P67775 | NA | In vitro | 11593413, | Europe PMC | |
| PPP2CB | P62714 | NA | In vitro | 11593413, | Europe PMC | |
| PTP4A3 | O75365 | NA | In vivo | 11355880, | Europe PMC | |
| PTPN1 | P18031 | NA | In vivo | 8940134, 9418872, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04015 | Rap1 signaling pathway | Rap1 is a small GTPase that controls diverse processes, such as cell adhesion, cell-cell junction formation and cell polarity. Like all G proteins, Rap1 cycles between an inactive GDP-bound and an active GTP-bound conformation. A variety of extracellular signals control this cycle through the regulation of several unique guanine nucleotide exchange factors (GEFs) and GTPase activating proteins (GAPs). Rap1 plays a dominant role in the control of cell-cell and cell-matrix interactions by regulating the function of integrins and other adhesion molecules in various cell types. Rap1 also regulates MAP kinase (MAPK) activity in a manner highly dependent on the context of cell types. |
| hsa04062 | Chemokine signaling pathway | Inflammatory immune response requires the recruitment of leukocytes to the site of inflammation upon foreign insult. Chemokines are small chemoattractant peptides that provide directional cues for the cell trafficking and thus are vital for protective host response. In addition, chemokines regulate plethora of biological processes of hematopoietic cells to lead cellular activation, differentiation and survival.The chemokine signal is transduced by chemokine receptors (G-protein coupled receptors) expressed on the immune cells. After receptor activation, the alpha- and beta-gamma-subunits of G protein dissociate to activate diverse downstream pathways resulting in cellular polarization and actin reorganization. Various members of small GTPases are involved in this process. Induction of nitric oxide and production of reactive oxygen species are as well regulated by chemokine signal via calcium mobilization and diacylglycerol production. |
| hsa04510 | Focal adhesion | Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. |
| hsa04670 | Leukocyte transendothelial migration | Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion. |
| hsa04810 | Regulation of actin cytoskeleton | |
| hsa05100 | Bacterial invasion of epithelial cells | Many pathogenic bacteria can invade phagocytic and non-phagocytic cells and colonize them intracellularly, then become disseminated to other cells. Invasive bacteria induce their own uptake by non-phagocytic host cells (e.g. epithelial cells) using two mechanisms referred to as zipper model and trigger model. Listeria, Staphylococcus, Streptococcus, and Yersinia are examples of bacteria that enter using the zipper model. These bacteria express proteins on their surfaces that interact with cellular receptors, initiating signalling cascades that result in close apposition of the cellular membrane around the entering bacteria. Shigella and Salmonella are the examples of bacteria entering cells using the trigger model. These bacteria use type III secretion systems to inject protein effectors that interact with the actin cytoskeleton. |
| hsa05163 | Human cytomegalovirus infection | Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-186763 | Downstream signal transduction. | The role of autophosphorylation sites on PDGF receptors are to provide docking sites for downstream signal transduction molecules which contain SH2 domains. The SH2 domain is a conserved motif of around 100 amino acids that can bind a phosphorylated tyrosine residue. These downstream molecules are activated upon binding to, or phosphorylated by, the receptor kinases intrinsic to PDGF receptors.Some of the dowstream molecules are themselves enzymes, such as phosphatidylinositol 3'-kinase (PI3K), phospholipase C (PLC-gamma), the Src family of tyrosine kinases, the tyrosine phosphatase SHP2, and a GTPase activating protein (GAP) for Ras. Others such as Grb2 are adaptor molecules which link the receptor with downstream catalytic molecules |
| R-HSA-372708 | p130Cas linkage to MAPK signaling for integrins. | Integrin signaling is linked to the MAP kinase pathway by recruiting p130cas and Crk to the FAK/Src activation complex |
| R-HSA-4420097 | VEGFA-VEGFR2 Pathway. | Angiogenesis is the formation of new blood vessels from preexisting vasculature. One of the most important proangiogenic factors is vascular endothelial growth factor (VEGF). VEGF exerts its biologic effect through interaction with transmembrane tyrosine kinase receptors VEGFR, selectively expressed on vascular endothelial cells. VEGFA signaling through VEGFR2 is the major pathway that activates angiogenesis by inducing the proliferation, survival, sprouting and migration of endothelial cells (ECs), and also by increasing endothelial permeability (Lohela et al. 2009, Shibuya & Claesson-Welsh 2006, Claesson-Welsh & Welsh, 2013). The critical role of VEGFR2 in vascular development is highlighted by the fact that VEGFR2-/- mice die at E8.5-9.5 due to defective development of blood islands, endothelial cells and haematopoietic cells (Shalaby et al. 1995) |
| R-HSA-8849471 | PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases. | PTK6 promotes cell motility and migration by regulating the activity of RHO GTPases RAC1 (Chen et al. 2004) and RHOA (Shen et al. 2008). PTK6 inhibits RAS GTPase activating protein RASA1 (Shen et al. 2008) and may be involved in MAPK7 (ERK5) activation (Ostrander et al. 2007, Zheng et al |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ALK | Affinity Capture-MS, Affinity Capture-Western | physical | 16105984, (Europe PMC) | NA | BioGRID |
| ARHGAP32 | Affinity Capture-Western, Reconstituted Complex | physical | 12446789, 12819203, (Europe PMC) | NA | BioGRID |
| ARMCX3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| BCAR3 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, molecular sieving | direct interaction, physical, physical association | 12517963, 22081014, 28514442, (Europe PMC) | 0.61 | BioGRID, IntAct |
| BMX | Protein-peptide | physical | 22974441, (Europe PMC) | NA | BioGRID |
| CBL | Affinity Capture-Western | physical | 8683103, (Europe PMC) | NA | BioGRID |
| CD2AP | Affinity Capture-Western, Reconstituted Complex | physical | 10339567, 12618476, (Europe PMC) | NA | BioGRID |
| CDC42 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 17038317, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| CRK | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| CRKL | Affinity Capture-Western, Far Western, Protein-peptide, pull down | association, physical | 18835194, 22974441, 23770091, 8810278, 9498705, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| DOCK1 | Affinity Capture-Western, Reconstituted Complex | physical | 12615911, (Europe PMC) | NA | BioGRID |
| E2F2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EFS | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EPN1 | Co-fractionation, anti bait coimmunoprecipitation | association, physical | 22863883, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ERBB2 | Affinity Capture-Western | physical | 26716506, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-Western | physical | 15020686, 19331827, (Europe PMC) | NA | BioGRID |
| FXYD6 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FYN | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 10739664, 17474147, 9188452, 9360983, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct, MINT |
| GMPR2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-Western, Reconstituted Complex | physical | 10085298, 10822386, 16105984, (Europe PMC) | NA | BioGRID |
| HCK | Reconstituted Complex | physical | 9020138, (Europe PMC) | NA | BioGRID |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| HSPA5 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| HYOU1 | Co-fractionation, anti bait coimmunoprecipitation | association, physical | 22863883, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ID2 | Affinity Capture-Western | physical | 10502414, (Europe PMC) | NA | BioGRID |
| INPPL1 | Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 11158326, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ITGAV | Affinity Capture-Western | physical | 16600665, (Europe PMC) | NA | BioGRID |
| KIF13A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| LCK | Reconstituted Complex | physical | 9020138, (Europe PMC) | NA | BioGRID |
| LYN | Affinity Capture-Western | physical | 9020138, 9581808, (Europe PMC) | NA | BioGRID |
| MAPK14 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPK8 | Affinity Capture-Western | physical | 11432831, (Europe PMC) | NA | BioGRID |
| MMP14 | Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical, physical association | 18164686, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| NCK1 | Affinity Capture-Western, Protein-peptide | physical | 12135674, 22974441, (Europe PMC) | NA | BioGRID |
| NEDD9 | Affinity Capture-Western | physical | 10502414, (Europe PMC) | NA | BioGRID |
| NPHP1 | Affinity Capture-Western, Two-hybrid | physical | 10739664, 11493697, 18477472, (Europe PMC) | NA | BioGRID |
| PIK3R1 | Affinity Capture-Western, Reconstituted Complex | physical | 10799562, (Europe PMC) | NA | BioGRID |
| PPP1R15A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTEN | Reconstituted Complex | physical | 9927060, (Europe PMC) | NA | BioGRID |
| PTK2 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| PTK2B | Affinity Capture-Western, Two-hybrid | physical | 11036077, 12893833, 8995252, 9020138, (Europe PMC) | NA | BioGRID |
| PTPN1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| PTPN11 | Affinity Capture-Western | physical | 9188452, (Europe PMC) | NA | BioGRID |
| PTPN12 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| PTPRH | Reconstituted Complex | physical | 11278335, (Europe PMC) | NA | BioGRID |
| PXN | Affinity Capture-Western | physical | 11577104, 8810278, (Europe PMC) | NA | BioGRID |
| RAN | Two-hybrid | physical | 11032817, (Europe PMC) | NA | BioGRID |
| RAPGEF1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 9748234, (Europe PMC) | NA | BioGRID |
| SFN | Affinity Capture-MS, tandem affinity purification | physical, physical association | 15778465, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| SH2D3A | Affinity Capture-Western | physical | 10187783, (Europe PMC) | NA | BioGRID |
| SH2D3C | Affinity Capture-Western, anti bait coimmunoprecipitation, cosedimentation in solution, ion exchange chromatography, molecular sieving, pull down, x-ray crystallography | direct interaction, physical, physical association | 10692442, 22081014, (Europe PMC) | 0.69 | BioGRID, IntAct |
| SH3KBP1 | Affinity Capture-Western | physical | 11071869, 12618476, (Europe PMC) | NA | BioGRID |
| SRC | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down | association, physical, physical association | 10085298, 10487518, 10542110, 10739664, 11514617, 12397603, 12615911, 15020686, 16849545, 17038317, 17129785, 21034468, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| SRCIN1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical, physical association | 14657239, (Europe PMC) | 0.46 | BioGRID, IntAct |
| TNK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down | physical, physical association | 17038317, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| TNS1 | Affinity Capture-Western | physical | 8810278, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIP6 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 11782456, 14688263, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TSEN34 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TSG101 | Affinity Capture-Western, Co-localization | physical | 27764233, (Europe PMC) | NA | BioGRID |
| UHRF2 | Far Western, antibody array | physical, physical association | 21952639, (Europe PMC) | 0.40 | BioGRID, IntAct |
| VCL | Affinity Capture-Western, two hybrid array, two hybrid prey pooling approach | physical, physical association | 11577104, (Europe PMC) | 0.49 | BioGRID, IntAct |
| VPS11 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 17979178, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10026197, (Europe PMC) | NA | BioGRID |
| ZYX | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 11782456, (Europe PMC) | 0.40 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACOT9 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ACTB | fluorescence microscopy | colocalization | 18164686, (Europe PMC) | 0.27 | IntAct, MINT |
| ACTG1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ACTN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ADD3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AFDN | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AKAP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ALB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ALDOA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ANXA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AP2S1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARF4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARHGEF11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARMCX1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARPC5L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ASCC3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ATP6V0D1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ATP6V1E1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BCAR3 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, molecular sieving | direct interaction, physical, physical association | 12517963, 22081014, 28514442, (Europe PMC) | 0.61 | BioGRID, IntAct |
| BSG | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CACNA2D1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CALD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CALR | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CALU | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CAPN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CAPZB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CCDC124 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CCT7 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CDC42 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 17038317, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| CDC42BPB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CDK11A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CEP290 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CETN2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CGNL1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CLIC1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CNP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| COPG1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CRIP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CRK | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| CRKL | Affinity Capture-Western, Far Western, Protein-peptide, pull down | association, physical | 18835194, 22974441, 23770091, 8810278, 9498705, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CSRP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CSRP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CTSB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CTTN | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CYR61 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DECR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DHX29 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DHX36 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DNAJA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DNAJB4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DPM1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DSC1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| E2F2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EDF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EFS | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGFR | anti bait coimmunoprecipitation | association | 15657067, (Europe PMC) | 0.35 | IntAct |
| EIF3D | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF3F | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF3H | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF4G1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF4G2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ELOC | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EPB41 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EPN1 | Co-fractionation, anti bait coimmunoprecipitation | association, physical | 22863883, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EPRS | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ETF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EWSR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FAM120A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FARSB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FGD5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FHOD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FKBP3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FLII | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FLNB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FMNL3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FSCN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FXR2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FXYD6 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FYN | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 10739664, 17474147, 9188452, 9360983, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct, MINT |
| GAK | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GAPDH | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GIGYF2 {ECO:0000303|PubMed:12771153, | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GLUD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GLUD2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GRSF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HBB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HBD | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HMGB1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HSP90AA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HSP90AB2P | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HSPA5 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| HTRA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HYOU1 | Co-fractionation, anti bait coimmunoprecipitation | association, physical | 22863883, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IDH2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| INPP5K | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| INPPL1 | Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 11158326, (Europe PMC) | 0.40 | BioGRID, IntAct |
| IQGAP1 | anti bait coimmunoprecipitation, pull down | association, physical association | 28007913, (Europe PMC) | 0.58 | IntAct |
| KANK1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KATNAL2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KCTD12 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KIF1A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KIF1B | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KIF1C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KRBA2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LDHA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LEMD2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LMAN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LRRC59 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LRRFIP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LUC7L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MACF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MAPK14 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MARCKSL1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MICAL2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MMP14 | Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical, physical association | 18164686, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| MOV10 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MPRIP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYH11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYO18A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYO1C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYO6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NAP1L1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NAPA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NAPB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NCL | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NEXN | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NPHP4 | anti tag coimmunoprecipitation | association | 15661758, (Europe PMC) | 0.35 | IntAct |
| NUMB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| OCRL | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| P4HA2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| P4HB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PA2G4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PABPC1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PABPC3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PBXIP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PDE4DIP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PDIA6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PEAK1 | anti tag coimmunoprecipitation | association, physical association | 20534451, (Europe PMC) | 0.50 | IntAct |
| PFN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PGD | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PGK1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PLOD3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PNPT1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPM1G | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP1CA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP1R15A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP1R18 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP2CA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP2CB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRDX2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRDX6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRKRA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRRC2C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PSMD11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PSMD4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PTK2 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| PTMA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PTPN1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| PTPN12 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| PTPN14 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| QKI | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RAI14 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RBM39 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RCN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RDX | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL10A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL13A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL18A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL26 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL27 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL39 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL39P5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL7 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPLP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPS11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPS17 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPS6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SAMD9L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SARS | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SET | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SFN | Affinity Capture-MS, tandem affinity purification | physical, physical association | 15778465, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| SH2D3C | Affinity Capture-Western, anti bait coimmunoprecipitation, cosedimentation in solution, ion exchange chromatography, molecular sieving, pull down, x-ray crystallography | direct interaction, physical, physical association | 10692442, 22081014, (Europe PMC) | 0.69 | BioGRID, IntAct |
| SH3BGRL3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SHROOM2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SIPA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SLC25A11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SLFN5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SND1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SNX18 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SPIRE1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SPTAN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SPTBN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRC | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down | association, physical, physical association | 10085298, 10487518, 10542110, 10739664, 11514617, 12397603, 12615911, 15020686, 16849545, 17038317, 17129785, 21034468, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| SRCIN1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical, physical association | 14657239, (Europe PMC) | 0.46 | BioGRID, IntAct |
| SRGAP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRP54 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRPK1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRPK2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRPK3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SSR3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SSR4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| STIP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SYNE2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SYNJ1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TAOK2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TBCA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TFAM | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TFCP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TJP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TKT | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMOD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMOD3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMSB10 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMSB4X | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TNK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down | physical, physical association | 17038317, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| TNS3 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, physical association | 19732724, (Europe PMC) | 0.56 | IntAct |
| TPM3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TPP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TRIOBP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TRIP4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TRIP6 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 11782456, 14688263, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TUBA1C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TUBA4A | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| TUBB8 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TXNDC5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UACA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UBAP2L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UBP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UHRF2 | Far Western, antibody array | physical, physical association | 21952639, (Europe PMC) | 0.40 | BioGRID, IntAct |
| UPF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| USP10 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| VCL | Affinity Capture-Western, two hybrid array, two hybrid prey pooling approach | physical, physical association | 11577104, (Europe PMC) | 0.49 | BioGRID, IntAct |
| VPS11 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VPS39 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| YWHAE | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 17979178, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAH | tandem affinity purification | association | 17979178, (Europe PMC) | 0.35 | IntAct |
| ZC3H15 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ZYX | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 11782456, (Europe PMC) | 0.40 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CDC42 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 17038317, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| CRK | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| CRKL | Affinity Capture-Western, Far Western, Protein-peptide, pull down | association, physical | 18835194, 22974441, 23770091, 8810278, 9498705, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| FYN | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 10739664, 17474147, 9188452, 9360983, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct, MINT |
| MMP14 | Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical, physical association | 18164686, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| PTK2 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| PTPN1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| PTPN12 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| SFN | Affinity Capture-MS, tandem affinity purification | physical, physical association | 15778465, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| SRC | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down | association, physical, physical association | 10085298, 10487518, 10542110, 10739664, 11514617, 12397603, 12615911, 15020686, 16849545, 17038317, 17129785, 21034468, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| TNK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down | physical, physical association | 17038317, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABL1 | Affinity Capture-Western, Biochemical Activity | physical | 7780740, 8810278, (Europe PMC) | NA | BioGRID |
| ACOT9 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ACTB | fluorescence microscopy | colocalization | 18164686, (Europe PMC) | 0.27 | IntAct, MINT |
| ACTG1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ACTN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ADD3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AFDN | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AGO4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AKAP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ALB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ALDOA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ALK | Affinity Capture-MS, Affinity Capture-Western | physical | 16105984, (Europe PMC) | NA | BioGRID |
| ANXA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| AP2S1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARF4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARHGAP32 | Affinity Capture-Western, Reconstituted Complex | physical | 12446789, 12819203, (Europe PMC) | NA | BioGRID |
| ARHGEF11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARMCX1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ARMCX3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ARPC5L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ASCC3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ATP6V0D1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ATP6V1E1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BCAR3 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, molecular sieving | direct interaction, physical, physical association | 12517963, 22081014, 28514442, (Europe PMC) | 0.61 | BioGRID, IntAct |
| BMX | Protein-peptide | physical | 22974441, (Europe PMC) | NA | BioGRID |
| BSG | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CACNA2D1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CALD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CALR | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CALU | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CAPN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CAPZB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CBL | Affinity Capture-Western | physical | 8683103, (Europe PMC) | NA | BioGRID |
| CCDC124 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CCT7 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CD2AP | Affinity Capture-Western, Reconstituted Complex | physical | 10339567, 12618476, (Europe PMC) | NA | BioGRID |
| CDC42 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 17038317, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| CDC42BPB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CDK11A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CEP290 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CETN2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CGNL1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CLIC1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CNP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| COPG1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CRIP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CRK | Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down | association, physical, physical association | 10085298, 10329689, 10464310, 10747099, 10753828, 11278916, 11369773, 11839772, 12615911, 12799422, 14657239, 15492270, 15673687, 16267043, 17038317, 18835194, 19380743, 22974441, 9581808, 9920935, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| CRKL | Affinity Capture-Western, Far Western, Protein-peptide, pull down | association, physical | 18835194, 22974441, 23770091, 8810278, 9498705, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CSRP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CSRP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CTSB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CTTN | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| CYR61 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DECR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DHX29 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DHX36 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DNAJA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DNAJB4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DOCK1 | Affinity Capture-Western, Reconstituted Complex | physical | 12615911, (Europe PMC) | NA | BioGRID |
| DPM1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| DSC1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| E2F2 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EDF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EFS | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGFR | anti bait coimmunoprecipitation | association | 15657067, (Europe PMC) | 0.35 | IntAct |
| EIF3D | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF3F | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF3H | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF4G1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EIF4G2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ELOC | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EPB41 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EPN1 | Co-fractionation, anti bait coimmunoprecipitation | association, physical | 22863883, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EPRS | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ERBB2 | Affinity Capture-Western | physical | 26716506, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-Western | physical | 15020686, 19331827, (Europe PMC) | NA | BioGRID |
| ETF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| EWSR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FAM120A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FARSB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FGD5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FHOD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FKBP3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FLII | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FLNB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FMNL3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FSCN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FXR2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| FXYD6 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FYN | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 10739664, 17474147, 9188452, 9360983, (Europe PMC) | 0.49, 0.62 | BioGRID, IntAct, MINT |
| GAK | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GAPDH | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GIGYF2 {ECO:0000303|PubMed:12771153, | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GLUD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GLUD2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| GMPR2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-Western, Reconstituted Complex | physical | 10085298, 10822386, 16105984, (Europe PMC) | NA | BioGRID |
| GRSF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HBB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HBD | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HCK | Reconstituted Complex | physical | 9020138, (Europe PMC) | NA | BioGRID |
| HMGB1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HSP90AB2P | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HSPA5 | Two-hybrid | physical | 16169070, (Europe PMC) | NA | BioGRID |
| HSPA5 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| HTRA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| HYOU1 | Co-fractionation, anti bait coimmunoprecipitation | association, physical | 22863883, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ID2 | Affinity Capture-Western | physical | 10502414, (Europe PMC) | NA | BioGRID |
| IDH2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| INPP5K | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| INPPL1 | Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation | physical, physical association | 11158326, (Europe PMC) | 0.40 | BioGRID, IntAct |
| IQGAP1 | anti bait coimmunoprecipitation, pull down | association, physical association | 28007913, (Europe PMC) | 0.58 | IntAct |
| ITGAV | Affinity Capture-Western | physical | 16600665, (Europe PMC) | NA | BioGRID |
| KANK1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KATNAL2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KCTD12 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KIF13A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| KIF1A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KIF1B | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KIF1C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| KRBA2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LCK | Reconstituted Complex | physical | 9020138, (Europe PMC) | NA | BioGRID |
| LDHA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LEMD2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LMAN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LRRC59 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LRRFIP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LUC7L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| LYN | Affinity Capture-Western | physical | 9020138, 9581808, (Europe PMC) | NA | BioGRID |
| MACF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MAPK14 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPK8 | Affinity Capture-Western | physical | 11432831, (Europe PMC) | NA | BioGRID |
| MARCKSL1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MICAL2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MMP14 | Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy | colocalization, physical, physical association | 18164686, (Europe PMC) | 0.46 | BioGRID, IntAct, MINT |
| MOV10 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MPRIP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYH11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYO18A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYO1C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| MYO6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NAP1L1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NAPA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NAPB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NCK1 | Affinity Capture-Western, Protein-peptide | physical | 12135674, 22974441, (Europe PMC) | NA | BioGRID |
| NCL | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NEDD9 | Affinity Capture-Western | physical | 10502414, (Europe PMC) | NA | BioGRID |
| NEXN | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| NPHP1 | Affinity Capture-Western, Two-hybrid | physical | 10739664, 11493697, 18477472, (Europe PMC) | NA | BioGRID |
| NPHP4 | anti tag coimmunoprecipitation | association | 15661758, (Europe PMC) | 0.35 | IntAct |
| NUMB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| OCRL | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| P4HA2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| P4HB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PA2G4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PABPC1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PABPC3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PBXIP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PDE4DIP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PDIA6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PEAK1 | anti tag coimmunoprecipitation | association, physical association | 20534451, (Europe PMC) | 0.50 | IntAct |
| PFN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PGD | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PGK1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PIK3R1 | Affinity Capture-Western, Reconstituted Complex | physical | 10799562, (Europe PMC) | NA | BioGRID |
| PLOD3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PNPT1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPM1G | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP1CA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP1R15A | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP1R18 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP2CA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PPP2CB | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRDX2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRDX6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRKRA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PRRC2C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PSMD11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PSMD4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PTEN | Reconstituted Complex | physical | 9927060, (Europe PMC) | NA | BioGRID |
| PTK2 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| PTK2B | Affinity Capture-Western, Two-hybrid | physical | 11036077, 12893833, 8995252, 9020138, (Europe PMC) | NA | BioGRID |
| PTMA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PTPN1 | Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay | association, dephosphorylation reaction, direct interaction, physical, physical association | 10889023, 15866871, 8940134, 9407132, 9418872, (Europe PMC) | 0.79 | BioGRID, IntAct, MINT |
| PTPN11 | Affinity Capture-Western | physical | 9188452, (Europe PMC) | NA | BioGRID |
| PTPN12 | Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down | direct interaction, physical, physical association | 12714323, 27880917, 8887669, 9285683, 9748319, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| PTPN14 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| PTPRH | Reconstituted Complex | physical | 11278335, (Europe PMC) | NA | BioGRID |
| PXN | Affinity Capture-Western | physical | 11577104, 8810278, (Europe PMC) | NA | BioGRID |
| QKI | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RAI14 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RAN | Two-hybrid | physical | 11032817, (Europe PMC) | NA | BioGRID |
| RAPGEF1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 9748234, (Europe PMC) | NA | BioGRID |
| RBM39 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RCN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RDX | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL10A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL13A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL18A | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL26 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL27 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL39 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL39P5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPL7 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPLP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPS11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPS17 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| RPS6 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SAMD9L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SARS | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SET | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SFN | Affinity Capture-MS, tandem affinity purification | physical, physical association | 15778465, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| SH2D3A | Affinity Capture-Western | physical | 10187783, (Europe PMC) | NA | BioGRID |
| SH2D3C | Affinity Capture-Western, anti bait coimmunoprecipitation, cosedimentation in solution, ion exchange chromatography, molecular sieving, pull down, x-ray crystallography | direct interaction, physical, physical association | 10692442, 22081014, (Europe PMC) | 0.69 | BioGRID, IntAct |
| SH3BGRL3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SH3KBP1 | Affinity Capture-Western | physical | 11071869, 12618476, (Europe PMC) | NA | BioGRID |
| SHROOM2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SIPA1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SLC25A11 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SLFN5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SND1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SNX18 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SPIRE1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SPTAN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SPTBN1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRC | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down | association, physical, physical association | 10085298, 10487518, 10542110, 10739664, 11514617, 12397603, 12615911, 15020686, 16849545, 17038317, 17129785, 21034468, (Europe PMC) | 0.69 | BioGRID, IntAct, MINT |
| SRCIN1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy | colocalization, physical, physical association | 14657239, (Europe PMC) | 0.46 | BioGRID, IntAct |
| SRGAP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRP54 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRPK1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRPK2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SRPK3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SSR3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SSR4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| STIP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SYNE2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| SYNJ1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TAOK2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TBCA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TFAM | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TFCP2 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TJP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TKT | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMOD1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMOD3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMSB10 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TMSB4X | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TNK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, pull down | physical, physical association | 17038317, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| TNS1 | Affinity Capture-Western | physical | 8810278, (Europe PMC) | NA | BioGRID |
| TNS3 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, physical association | 19732724, (Europe PMC) | 0.56 | IntAct |
| TPM3 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TPP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIOBP | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TRIP4 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TRIP6 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 11782456, 14688263, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TSEN34 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TSG101 | Affinity Capture-Western, Co-localization | physical | 27764233, (Europe PMC) | NA | BioGRID |
| TUBA1C | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TUBA4A | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| TUBB8 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| TXNDC5 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UACA | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UBAP2L | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UBP1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| UHRF2 | Far Western, antibody array | physical, physical association | 21952639, (Europe PMC) | 0.40 | BioGRID, IntAct |
| UPF1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| USP10 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| VCL | Affinity Capture-Western, two hybrid array, two hybrid prey pooling approach | physical, physical association | 11577104, (Europe PMC) | 0.49 | BioGRID, IntAct |
| VPS11 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VPS39 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| YWHAE | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 17979178, 28007913, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAH | tandem affinity purification | association | 17979178, (Europe PMC) | 0.35 | IntAct |
| YWHAZ | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10026197, (Europe PMC) | NA | BioGRID |
| ZC3H15 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| ZYX | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 11782456, (Europe PMC) | 0.40 | BioGRID, IntAct |