DEPOD - human DEPhOsphorylation Database

Basic Information
Phosphatases
Pathway
Interacting Proteins
Phosphorylating Kinases

Gene Name	AXIN1 (QuickGO)	Interactive visualization of AXIN1 structures (A quick tutorial to explore the interctive visulaization) Representative structure: 4NM7
Synonyms	AXIN1, AXIN
Protein Name	AXIN1
Alternative Name(s)	Axin-1;Axis inhibition protein 1;hAxin;
Protein Family	noSimilarity_annotations
EntrezGene ID	8312 (Comparitive Toxicogenomics)
UniProt AC (Human)	O15169 (protein sequence)
Enzyme Class	N/A
Molecular Weight	95635 Dalton
Protein Length	862 amino acids (AA)
Genome Browsers	NCBI \| ENSG00000103126 (Ensembl) \| UCSC
Crosslinking annotations	Query our ID-mapping table
Orthologues	Quest For Orthologues (QFO) \| GeneTree \| eggNOG - KOG3589 \| eggNOG - ENOG410YMJD
Phosphorylation Network	Visualize

Domain organization, Expression, Diseases

(show / hide)

Localization, Function, Catalytic activity and Sequence

(show / hide)

Localization (UniProt annotation)
Cytoplasm Nucleus Membrane Cell membrane Note=MACF1 is required for itstranslocation to cell membrane (By similarity) On UV irradiation,translocates to the nucleus and colocalizes with DAAX(PubMed:17210684)
Function (UniProt annotation)
Component of the beta-catenin destruction complexrequired for regulating CTNNB1 levels through phosphorylation andubiquitination, and modulating Wnt-signaling (PubMed:12192039,PubMed:27098453) Controls dorsoventral patterning via twoopposing effects; down-regulates CTNNB1 to inhibit the Wntsignaling pathway and ventralize embryos, but also dorsalizesembryos by activating a Wnt-independent JNK signaling pathway(PubMed:12192039) In Wnt signaling, probably facilitates thephosphorylation of CTNNB1 and APC by GSK3B (PubMed:12192039)Likely to function as a tumor suppressor Enhances TGF-betasignaling by recruiting the RNF111 E3 ubiquitin ligase andpromoting the degradation of inhibitory SMAD7 (PubMed:16601693)Also component of the AXIN1-HIPK2-TP53 complex which controls cellgrowth, apoptosis and development (PubMed:17210684) Facilitatesthe phosphorylation of TP53 by HIPK2 upon ultraviolet irradiation(PubMed:17210684)
Catalytic Activity (UniProt annotation)
N/A
Protein Sequence
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTP PYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQT KPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSAND SEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQ RTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLR TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQS SFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGE KEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKR ASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLV RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD

Motif information from Eukaryotic Linear Motif atlas (ELM)

(show / hide)

Gene Ontology (P: Process; F: Function and C: Component terms)

(show / hide)

GO:0001743	P:optic placode formation
GO:0001934	P:positive regulation of protein phosphorylation
GO:0005096	F:GTPase activator activity
GO:0005634	C:nucleus
GO:0005737	C:cytoplasm
GO:0005829	C:cytosol
GO:0006915	P:apoptotic process
GO:0007257	P:activation of JUN kinase activity
GO:0007368	P:determination of left/right symmetry
GO:0008013	F:beta-catenin binding
GO:0010800	P:positive regulation of peptidyl-threonine phosphorylation
GO:0016055	P:Wnt signaling pathway
GO:0016328	C:lateral plasma membrane
GO:0019899	F:enzyme binding
GO:0019901	F:protein kinase binding
GO:0021797	P:forebrain anterior/posterior pattern specification
GO:0021881	P:Wnt-activated signaling pathway involved in forebrain neuron fate commitment
GO:0030111	P:regulation of Wnt signaling pathway
GO:0030159	F:receptor signaling complex scaffold activity
GO:0030877	C:beta-catenin destruction complex
GO:0030910	P:olfactory placode formation
GO:0031122	P:cytoplasmic microtubule organization
GO:0031398	P:positive regulation of protein ubiquitination
GO:0031410	C:cytoplasmic vesicle
GO:0031625	F:ubiquitin protein ligase binding
GO:0032147	P:activation of protein kinase activity
GO:0032947	F:protein-containing complex scaffold activity
GO:0033138	P:positive regulation of peptidyl-serine phosphorylation
GO:0033146	P:regulation of intracellular estrogen receptor signaling pathway
GO:0034244	P:negative regulation of transcription elongation from RNA polymerase II promoter
GO:0034622	P:cellular protein-containing complex assembly
GO:0035591	F:signaling adaptor activity
GO:0042802	F:identical protein binding
GO:0042803	F:protein homodimerization activity
GO:0045599	P:negative regulation of fat cell differentiation
GO:0045732	P:positive regulation of protein catabolic process
GO:0045893	P:positive regulation of transcription
GO:0046330	DNA-templated
GO:0046332	P:positive regulation of JNK cascade
GO:0048048	F:SMAD binding
GO:0048320	P:embryonic eye morphogenesis
GO:0048471	P:axial mesoderm formation
GO:0051443	C:perinuclear region of cytoplasm
GO:0055001	P:positive regulation of ubiquitin-protein transferase activity
GO:0060272	P:muscle cell development
GO:0060823	P:embryonic skeletal joint morphogenesis
GO:0070016	P:canonical Wnt signaling pathway involved in neural plate anterior/posterior pattern formation
GO:0070411	F:armadillo repeat domain binding
GO:0071944	F:I-SMAD binding
GO:0090090	C:cell periphery
GO:0090263	P:negative regulation of canonical Wnt signaling pathway
GO:1904885	P:positive regulation of canonical Wnt signaling pathway
GO:1904886	P:beta-catenin destruction complex assembly
GO:2000060	P:beta-catenin destruction complex disassembly

KEGG Pathway
Reactome Pathway

Pathway ID	Pathway Name	Pathway Description (KEGG)
hsa04310	Wnt signaling pathway	Wnt proteins are secreted morphogens that are required for basic developmental processes, such as cell-fate specification, progenitor-cell proliferation and the control of asymmetric cell division, in many different species and organs. There are at least three different Wnt pathways: the canonical pathway, the planar cell polarity (PCP) pathway and the Wnt/Ca2+ pathway. In the canonical Wnt pathway, the major effect of Wnt ligand binding to its receptor is the stabilization of cytoplasmic beta-catenin through inhibition of the bea-catenin degradation complex. Beta-catenin is then free to enter the nucleus and activate Wnt-regulated genes through its interaction with TCF (T-cell factor) family transcription factors and concomitant recruitment of coactivators. Planar cell polarity (PCP) signaling leads to the activation of the small GTPases RHOA (RAS homologue gene-family member A) and RAC1, which activate the stress kinase JNK (Jun N-terminal kinase) and ROCK (RHO-associated coiled-coil-containing protein kinase 1) and leads to remodelling of the cytoskeleton and changes in cell adhesion and motility. WNT-Ca2+ signalling is mediated through G proteins and phospholipases and leads to transient increases in cytoplasmic free calcium that subsequently activate the kinase PKC (protein kinase C) and CAMKII (calcium calmodulin mediated kinase II) and the phosphatase calcineurin.
hsa04390	Hippo signaling pathway	Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors.
hsa04550	Signaling pathways regulating pluripotency of stem cells	Pluripotent stem cells (PSCs) are basic cells with an indefinite self-renewal capacity and the potential to generate all the cell types of the three germinal layers. The types of PSCs known to date include embryonic stem (ES) and induced pluripotent stem (iPS) cells. ES cells are derived from the inner cell mass (ICM) of blastocyst-stage embryos. iPS cells are generated by reprogramming somatic cells back to pluripotent state with defined reprogramming factors, Oct4, Sox2, Klf4 and c-Myc (also known as Yamanaka factors). PSCs including ES cells and iPS cells are categorized into two groups by their morphology, gene expression profile and external signal dependence. Conventional mouse-type ES/iPS cells are called 'naive state' cells. They are mainly maintained under the control of LIF and BMP signaling. On the other hand, human-type ES/iPS cells, which are in need of Activin and FGF signaling, are termed 'primed state'. However, these signaling pathways converge towards the activation of a core transcriptional network that is similar in both groups and involves OCt4, Nanog and Sox2. The three transcription factors and their downstream target genes coordinately promote self-renewal and pluripotency.
hsa04934	Cushing syndrome	Cushing syndrome (CS) is a rare disorder resulting from prolonged exposure to excess glucocorticoids via exogenous and endogenous sources. The typical clinical features of CS are related to hypercortisolism and include accumulation of central fat, moon facies, neuromuscular weakness, osteoporosis or bone fractures, metabolic complications, and mood changes. Traditionally, endogenous CS is classified as adrenocorticotropic hormone (ACTH)-dependent (about 80%) or ACTH- independent (about 20%). Among ACTH-dependent forms, pituitary corticotroph adenoma (Cushing's disease) is most common. Most pituitary tumors are sporadic, resulting from monoclonal expansion of a single mutated cell. Recently recurrent activating somatic driver mutations in the ubiquitin-specific protease 8 gene (USP8) were identified in almost half of corticotroph adenoma. Germline mutations in MEN1 (encoding menin), AIP (encoding aryl-hydrocarbon receptor-interacting protein), PRKAR1A (encoding cAMP-dependent protein kinase type I alpha regulatory subunit) and CDKN1B (encoding cyclin-dependent kinase inhibitor 1B; also known as p27 Kip1) have been identified in familial forms of pituitary adenomas. However, the frequency of familial pituitary adenomas is less than 5% in patients with pituitary adenomas. Among ACTH-independent CS, adrenal adenoma is most common. Rare adrenal causes of CS include primary bilateral macronodular adrenal hyperplasia (BMAH) or primary pigmented nodular adrenocortical disease (PPNAD).
hsa05165	Human papillomavirus infection	Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation.
hsa05200	Pathways in cancer
hsa05210	Colorectal cancer	Colorectal cancer (CRC) is the second largest cause of cancer-related deaths in Western countries. CRC arises from the colorectal epithelium as a result of the accumulation of genetic alterations in defined oncogenes and tumour suppressor genes (TSG). Two major mechanisms of genomic instability have been identified in sporadic CRC progression. The first, known as chromosomal instability (CIN), results from a series of genetic changes that involve the activation of oncogenes such as K-ras and inactivation of TSG such as p53, DCC/Smad4, and APC. The second, known as microsatellite instability (MSI), results from inactivation of the DNA mismatch repair genes MLH1 and/or MSH2 by hypermethylation of their promoter, and secondary mutation of genes with coding microsatellites, such as transforming growth factor receptor II (TGF-RII) and BAX. Hereditary syndromes have germline mutations in specific genes (mutation in the tumour suppressor gene APC on chromosome 5q in FAP, mutated DNA mismatch repair genes in HNPCC).
hsa05213	Endometrial cancer	Endometrial cancer (EC) is the most common gynaecological malignancy and the fourth most common malignancy in women in the developed world after breast, colorectal and lung cancer. Two types of endometrial carcinoma are distinguished with respect to biology and clinical course. Type-I carcinoma is related to hyperestrogenism by association with endometrial hyperplasia, frequent expression of estrogen and progesterone receptors and younger age, whereas type-II carcinoma is unrelated to estrogen, associated with atrophic endometrium, frequent lack of estrogen and progesterone receptors and older age. The morphologic differences in these cancers are mirrored in their molecular genetic profile with type I showing defects in DNA-mismatch repair and mutations in PTEN, K-ras, and beta-catenin, and type II showing aneuploidy, p53 mutations, and her2/neu amplification.
hsa05217	Basal cell carcinoma	Cancer of the skin is the most common cancer in Caucasians and basal cell carcinomas (BCC) account for 90% of all skin cancers. The vast majority of BCC cases are sporadic, though there is a rare familial syndrome basal cell nevus syndrome (BCNS, or Gorlin syndrome) that predisposes to development of BCC. In addition, there is strong epidemiological and genetic evidence that demonstrates UV exposure as a risk factor of prime importance. The development of basal cell carcinoma is associated with constitutive activation of sonic hedgehog signaling. The mutations in SMOH, PTCH1, and SHH in BCCs result in continuous activation of target genes. At a cellular level, sonic hedgehog signaling promotes cell proliferation. Mutations in TP53 are also found with high frequency (>50%) in sporadic BCC.
hsa05224	Breast cancer	Breast cancer is the leading cause of cancer death among women worldwide. The vast majority of breast cancers are carcinomas that originate from cells lining the milk-forming ducts of the mammary gland. The molecular subtypes of breast cancer, which are based on the presence or absence of hormone receptors (estrogen and progesterone subtypes) and human epidermal growth factor receptor-2 (HER2), include: hormone receptor positive and HER2 negative (luminal A subtype), hormone receptor positive and HER2 positive (luminal B subtype), hormone receptor negative and HER2 positive (HER2 positive), and hormone receptor negative and HER2 negative (basal-like or triple-negative breast cancers (TNBCs)). Hormone receptor positive breast cancers are largely driven by the estrogen/ER pathway. In HER2 positive breast tumours, HER2 activates the PI3K/AKT and the RAS/RAF/MAPK pathways, and stimulate cell growth, survival and differentiation. In patients suffering from TNBC, the deregulation of various signalling pathways (Notch and Wnt/beta-catenin), EGFR protein have been confirmed. In the case of breast cancer only 8% of all cancers are hereditary, a phenomenon linked to genetic changes in BRCA1 or BRCA2. Somatic mutations in only three genes (TP53, PIK3CA and GATA3) occurred at >10% incidence across all breast cancers.
hsa05225	Hepatocellular carcinoma	Hepatocellular carcinoma (HCC) is a major type of primary liver cancer and one of the rare human neoplasms etiologically linked to viral factors. It has been shown that, after HBV/HCV infection and alcohol or aflatoxin B1 exposure, genetic and epigenetic changes occur. The recurrent mutated genes were found to be highly enriched in multiple key driver signaling processes, including telomere maintenance, TP53, cell cycle regulation, the Wnt/beta-catenin pathway (CTNNB1 and AXIN1), the phosphatidylinositol-3 kinase (PI3K)/AKT/mammalian target of rapamycin (mTOR) pathway. Recent studies using whole-exome sequencing have revealed recurrent mutations in new driver genes involved in the chromatin remodelling (ARID1A and ARID2) and the oxidative stress (NFE2L2) pathways.
hsa05226	Gastric cancer	Gastric cancer (GC) is one of the world's most common cancers. According to Lauren's histological classification gastric cancer is divided into two distinct histological groups - the intestinal and diffuse types. Several genetic changes have been identified in intestinal-type GC. The intestinal metaplasia is characterized by mutations in p53 gene, reduced expression of retinoic acid receptor beta (RAR-beta) and hTERT expression. Gastric adenomas furthermore display mutations in the APC gene, reduced p27 expression and cyclin E amplification. In addition, amplification and overexpression of c-ErbB2, reduced TGF-beta receptor type I (TGFBRI) expression and complete loss of p27 expression are commonly observed in more advanced GC. The main molecular changes observed in diffuse-type GCs include loss of E-cadherin function by mutations in CDH1 and amplification of MET and FGFR2F.

Pathway ID	Pathway Name	Pathway Description (KEGG)
R-HSA-195253	Degradation of beta-catenin by the destruction complex.	The beta-catenin destruction complex plays a key role in the canonical Wnt signaling pathway. In the absence of Wnt signaling, this complex controls the levels of cytoplamic beta-catenin. Beta-catenin associates with and is phosphorylated by the destruction complex. Phosphorylated beta-catenin is recognized and ubiquitinated by the SCF-beta TrCP ubiquitin ligase complex and is subsequently degraded by the proteasome (reviewed in Kimelman and Xu, 2006)
R-HSA-196299	Beta-catenin phosphorylation cascade.	Degradation of beta-catenin is initiated following amino-terminal serine/threonine phosphorylation. Phosphorylation of B-catenin at S45 by CK1 alpha primes the subsequent sequential GSK-3-mediated phosphorylation at Thr41, Ser37 and Ser33 (Amit et al., 2002 ; Lui et al., 2002)
R-HSA-201681	TCF dependent signaling in response to WNT.	19 WNT ligands and 10 FZD receptors have been identified in human cells; interactions amongst these ligands and receptors vary in a developmental and tissue-specific manner and lead to activation of so-called 'canonical' and 'non-canonical' WNT signaling. In the canonical WNT signaling pathway, binding of a WNT ligand to the Frizzled (FZD) and lipoprotein receptor-related protein (LRP) receptors results in the inactivation of the destruction complex, the stabilization and nuclear translocation of beta-catenin and subsequent activation of T-cell factor/lymphoid enhancing factor (TCF/LEF)-dependent transcription. Transcriptional activation in response to canonical WNT signaling controls processes such as cell fate, proliferation and self renewal of stem cells, as well as contributing to oncogenesis (reviewed in MacDonald et al, 2009; Saito-Diaz et al, 2013; Kim et al, 2013)
R-HSA-4641257	Degradation of AXIN.	AXIN is present in low concentrations in the cell and is considered to be the limiting component of the beta-catenin destruction complex in Xenopus; this may not be the case in mammalian cells, however (Lee et al, 2003; Tan et al, 2012). Cellular levels of AXIN are regulated in part through ubiquitin-mediated turnover. E3 ligases SMURF2 and RNF146 have both been shown to play a role in promoting the degradation of AXIN by the 26S proteasome (Kim and Jho, 2010; Callow et al, 2011; Zhang et al, 2011)
R-HSA-4641262	Disassembly of the destruction complex and recruitment of AXIN to the membrane.	Upon stimulation with WNT ligand, AXIN and GSK3beta are recruited to the plasma membrane through interaction with DVL (Tamai et al, 2004; Mao et al, 2001; reviewed in He et al, 2004). Polymerization of membrane-associated DVL and GSK3beta- and CSNK1-mediated phosphorylation of LRP5/6 establish a feed-forward mechanism for enhanced membrane recruitment of AXIN upon WNT signaling (Tamai et al, 2004; Cong et al, 2004; Zeng et al, 2005; Bilic et al, 2007). In Xenopus oocytes, but not necessarily all sytems, AXIN is present in limiting concentrations and is considered rate limiting for the assembly of the destruction complex (Lee et al, 2003; Benchabane et al, 2008; Tan et al, 2012; reviewed in MacDonald et al, 2009). The recruitment of AXIN away from the destruction complex upon WNT stimulation effectively destabilizes the destruction complex and contributes to the accumulation of free beta-catenin (Kikuchi, 1999; Lee et al, 2003). AXIN association with the destruction complex is also regulated by phosphorylation. In the active destruction complex, AXIN is phosphorylated by GSK3beta; dephosphorylation by protein phosphatase 1 (PP1) or protein phosphatase 2A (PP2A) destabilizes the interaction of AXIN with the other components of the destruction complex and promotes its disassembly (Luo et al, 2007; Willert et al, 1999; Jho et al, 1999). Free AXIN is also subject to degradation by the 26S proteasome in a manner that depends on the poly-ADP-ribosylating enzymes tankyrase 1 and 2 (Huang et al, 2009)
R-HSA-5339716	Misspliced GSK3beta mutants stabilize beta-catenin.	GSK3beta is subject to in-frame missplicing in CML stem cells resulting in the production of mutant protein that lacks the AXIN and FRAT binding domains. Cells containing this mutant GSK3beta show elevated levels of nuclear beta-catenin and enhanced TCF-dependent reporter activity (Jamieson et al, 2008; Abrahamsson et al, 2009)
R-HSA-5358747	S33 mutants of beta-catenin aren't phosphorylated.	S33 mutations of beta-catenin interfere with GSK3 phosphorylation and result in stabilization and nuclear localization of the protein and enhanced WNT signaling (Groen et al, 2008; Nhieu et al, 1999; Clements et al, 2002; reviewed in Polakis, 2000). S33 mutations have been identified in cancers of the central nervous system, liver, endometrium and stomach, among others (reviewed in Polakis, 2000)
R-HSA-5358749	S37 mutants of beta-catenin aren't phosphorylated.	S37 mutations of beta-catenin interfere with GSK3 phosphorylation and stabilize the protein, resulting in enhanced WNT pathway signaling (Nhieu et al, 1999; Clements et al, 2002; reviewed in Polakis, 2000). S37 mutations have been identified in cancers of the brain, liver, ovary and large intestine, among others (reviewed in Polakis, 2000)
R-HSA-5358751	S45 mutants of beta-catenin aren't phosphorylated.	S45 mutants of beta-catenin have been identified in colorectal and hepatocellular carcinomas, soft tissue cancer and Wilms Tumors, among others (reviewed in Polakis, 2000). These mutations abolish the CK1alpha phosphorylation site of beta-catenin which acts as a critical priming site for GSK3 phosphorylation of T41( and subsequently S37 and S33) thus preventing its ubiquitin-mediated degradation (Morin et al, 1997; Amit et al, 2002)
R-HSA-5358752	T41 mutants of beta-catenin aren't phosphorylated.	T41 mutations of beta-catenin interfere with GSK3 phosphorylation and result in stabilization and nuclear accumulation of the protein (Moreno-Bueno et al, 2002; Taniguchi et al, 2002; reviewed in Polakis, 2012). T41 mutations have been identified in cancers of the liver and brain, as well as in the pituitary, endometrium, large intestine and skin, among others (reviewed in Polakis, 2000; Saito-Diaz et al, 2013)
R-HSA-5467337	APC truncation mutants have impaired AXIN binding.	Mutations in the APC tumor suppressor gene are common in colorectal and other cancers and cluster in the central mutation cluster region (MCR) of the gene (Miyoshi et al, 1992; Nagase and Nakamura, 1993; Dihlmann et al, 1999; reviewed in Bienz and Clevers, 2000). These mutations generally result in truncated proteins that destabilize the destruction complex and result in elevated WNT pathway activation (reviewed in Polakis, 2000)
R-HSA-5467340	AXIN missense mutants destabilize the destruction complex.	Alterations in AXIN1 have been detected in a number of different cancers including liver and colorectal cancer and medullablastoma, among others (reviewed in Salahshor and Woodgett, 2005). Missense and nonsense mutations that disrupt or remove protein-protein interaction domains are common, and AXIN variants in cancers tend to disrupt the formation of a functional destruction complex (Satoh et al, 2000; Taniguchi et al, 2002; Webster et al, 2000; Shimizu et al, 2002)
R-HSA-5467348	Truncations of AMER1 destabilize the destruction complex.	AMER1/WTX is a known component of the destruction complex and interacts directly with beta-catenin through the C-terminal half (Major et al, 2007). siRNA depletion of AMER1 in mammalian cells stabilizes cellular beta-catenin levels and increases the expression of a beta-catenin-dependent reporter gene, suggesting that AMER1 is a tumor suppressor gene (Major et al, 2007; reviewed in Huff, 2011). Consistent with this, nonsense and missense mutations that truncate AMER1 and result in loss of the beta-catenin binding region have been identified in Wilms tumor, a pediatric kidney cancer (Ruteshouser et al, 2008; Wegert et al, 2009)
R-HSA-5689880	Ub-specific processing proteases.	Ub-specific processing proteases (USPs) are the largest of the DUB families with more than 50 members in humans. The USP catalytic domain varies considerably in size and consists of six conserved motifs with N- or C-terminal extensions and insertions occurring between the conserved motifs (Ye et al. 2009). Two highly conserved regions comprise the catalytic triad, the Cys-box (Cys) and His-box (His and Asp/Asn) (Nijman et al. 2005, Ye et al. 2009, Reyes-Turcu & Wilkinson 2009). They recognize their substrates by interactions of the variable regions with the substrate protein directly, or via scaffolds or adapters in multiprotein complexes
R-HSA-8931987	RUNX1 regulates estrogen receptor mediated transcription.	The RUNX1:CBFB complex can associate with the activated estrogen receptor alpha (ESR1) through direct interaction between RUNX1 and ESR1. The RUNX1:CBFB complex is thus involved in transcriptional regulation of estrogen responsive genes, including GPAM, KCTD6 and AXIN1 (Stender et al. 2010). High GPAM expression correlates with better overall survival in breast cancer (Brockmoller et al. 2012)
R-HSA-8939256	RUNX1 regulates transcription of genes involved in WNT signaling.	The RUNX1:CBFB complex directly regulates transcription of at least two components of WNT signaling. In association with its co-factor FOXP3, the RUNX1:CBFB complex stimulates transcription of the RSPO3 gene, encoding a WNT ligand that is implicated as a breast cancer oncogene (Recouvreux et al. 2016). In association with the activated estrogen receptor alpha (ESR1), the RUNX1:CBFB complex stimulates the expression of AXIN1, which functions as a regulator of WNT signaling (Stender et al. 2010)
R-HSA-9018519	Estrogen-dependent gene expression.	Estrogens mediate their transcriptional effects through interaction with the estrogen receptors, ESR1 (also known as ER alpha) and ESR2 (ER beta). ESR1 and ESR2 share overlapping but distinct functions, with ESR1 playing the primary role in transcriptional activation in most cell types (Hah and Krauss, 2014; Haldosén et al, 2014. The receptors function as ligand-dependent dimers and can activate target genes either through direct binding to an estrogen responsive element (ERE) in the target gene promoter, or indirectly through interaction with another DNA-binding protein such as RUNX1, SP1, AP1 or NF-kappa beta (reviewed in Bai and Gust, 2009; Hah and Krause, 2014). Binding of estrogen receptors to the DNA promotes the assembly of higher order transcriptional complexes containing methyltransferases, histone acetyltransferases and other transcriptional activators, which promote transcription by establishing active chromatin marks and by recruiting general transcription factors and RNA polymerase II. ESR1- and estrogen-dependent recruitment of up to hundreds of coregulators has been demonstrated by varied co-immunoprecipitation and proteomic approaches (Kittler et al, 2013; Mohammed et al, 2013; Foulds et al, 2013; Mohammed et al, 2015; Liu et al, 2014; reviewed in Magnani and Lupien, 2014; Arnal, 2017). In some circumstances, ligand-bound receptors can also promote the assembly of a repression complex at a target gene, and in some cases, heterodimers of ESR1 and ESR2 serve as repressors of ESR1-mediated target gene activation (reviewed in Hah and Kraus, 2014; Arnal et al, 2017). Phosphorylation of the estrogen receptor also modulates its activity, and provides cross-talk between nuclear estrogen-dependent signaling and non-genomic estrogen signaling from the plasma membrane (reviewed in Anbalagan and Rowan, 2015; Halodsèn et al, 2014; Schwartz et al, 2016) A number of recent genome wide studies highlight the breadth of the transcriptional response to estrogen. The number of predicted estrogen-dependent target genes ranges from a couple of hundred (based on microarray studies) to upwards of 10000, based on ChIP-chip or ChIP-seq (Cheung and Kraus, 2010; Kinnis and Kraus, 2008; Lin et al, 2004; Welboren et al, 2009; Ikeda et al, 2015; Lin et al, 2007; Carroll et al, 2006). Many of these predicted sites may not represent transcriptionally productive binding events, however. A study examining ESR1 binding by ChIP-seq in 20 primary breast cancers identified a core of 484 ESR-binding events that were conserved in at least 75% of ER+ tumors, which may represent a more realistic estimate (Ross-Innes et al, 2012). These studies also highlight the long-range effect of estrogen receptor-binding, with distal enhancer or promoter elements regulating the expression of many target genes, often through looping or other higher order chromatin structures (Kittler et al, 2013; reviewed in Dietz and Carroll, 2008; Liu and Cheung, 2014; Magnani and Lupien, 2014). Transcription from a number of estrogen-responsive target genes also appears to be primed by the binding of pioneering transcription factors such as FOXA1, GATA3, PBX1 among others

BioGRID
IntAct
MINT
ALL

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
ANP32A	Two-hybrid, pull down, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.51	BioGRID, IntAct
APC	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	10228155, 16199882, 20128690, 22682247, 23277359, 26496610, 29045831, 9734785, (Europe PMC)	NA	BioGRID
ARHGAP21	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
ARRB1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	19202075, (Europe PMC)	0.50	BioGRID, IntAct
AXIN1	Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, light scattering, molecular sieving, nuclear magnetic resonance, two hybrid pooling approach	direct interaction, physical, physical association	11884395, 16169070, 18632848, 21245303, 23892894, (Europe PMC)	0.40, 0.71	BioGRID, IntAct
AXIN2	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20128690, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
BTRC	Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti bait coimmunoprecipitation	association, physical	10228155, 22682247, 24976009, 25900982, 29045831, (Europe PMC)	0.35	BioGRID, IntAct
CARM1	Biochemical Activity	physical	21242974, (Europe PMC)	NA	BioGRID
CAV1	Affinity Capture-Western	physical	16890161, (Europe PMC)	NA	BioGRID
CRMP1	Two-hybrid, pull down, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.51	BioGRID, IntAct
CSNK1A1	Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, genetic, physical	11884395, 17510365, 22682247, 26496610, (Europe PMC)	0.64	BioGRID, IntAct
CSNK1D	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CSNK1E	Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, two hybrid	association, colocalization, genetic, physical, physical association	11884395, 21988832, 22682247, 26496610, (Europe PMC)	0.69	BioGRID, IntAct
CTNNA1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CTNNB1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10228155, 12421363, 12805222, 16199882, 16890161, 17318191, 17510365, 18593713, 18632848, 19131971, 19166851, 20128690, 20531388, 21242974, 22509369, 22682247, 22773187, 23892894, 23959799, 24976009, 26496610, 27902311, 29045831, 9734785, (Europe PMC)	0.40, 0.94	BioGRID, IntAct, MINT
DAB2	Reconstituted Complex	physical	12805222, (Europe PMC)	NA	BioGRID
DAXX	Affinity Capture-Western, Two-hybrid	physical	17210684, (Europe PMC)	NA	BioGRID
DVL1	Affinity Capture-Western	physical	10428961, 18632848, (Europe PMC)	NA	BioGRID
DVL2	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, nuclear magnetic resonance	association, direct interaction, physical, physical association	10829020, 21245303, 22773187, 23892894, (Europe PMC)	0.40, 0.59	BioGRID, IntAct, MINT
DVL3	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	12805222, 20128690, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
EEF1A1	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
FBXW11	Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	22682247, 25332235, 25900982, (Europe PMC)	0.56	BioGRID, IntAct
FOXM1	Affinity Capture-Western	physical	26912724, (Europe PMC)	NA	BioGRID
GAK	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
GAPVD1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
GNAS	Affinity Capture-Western, Reconstituted Complex	physical	16293724, (Europe PMC)	NA	BioGRID
GSK3A	Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17318175, 17510365, 19131971, 23602568, 23959799, 26496610, 26912724, (Europe PMC)	0.35, 0.67	BioGRID, IntAct, MINT
GSK3B	Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, fluorescence polarization spectroscopy, protein kinase assay, proximity ligation assay, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid	association, colocalization, direct interaction, phosphorylation reaction, physical, physical association	10228155, 10481074, 11738041, 12511557, 12584189, 16199882, 16293724, 16890161, 17318175, 17318191, 17510365, 17601533, 18593713, 18632848, 19131971, 19202075, 19303846, 19759537, 20128690, 21242974, 21502811, 21988832, 22270359, 22509369, 22613765, 22682247, 22773187, 23455922, 23602568, 23892894, 23959799, 24451375, 24976009, 25241761, 26496610, 26912724, 29045831, 29568061, 9734785, (Europe PMC)	0.40, 0.97	BioGRID, IntAct, MINT
HIPK2	Affinity Capture-Western	physical	21057547, 23826318, (Europe PMC)	NA	BioGRID
HTT	Affinity Capture-Western	physical	20531388, (Europe PMC)	NA	BioGRID
JUP	Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach, validated two hybrid	association, physical, physical association	26496610, 26871637, (Europe PMC)	0.67	BioGRID, IntAct
LMO2	Two-hybrid, confocal microscopy, two hybrid	colocalization, physical, physical association	21988832, (Europe PMC)	0.44	BioGRID, IntAct
LRP5	Affinity Capture-Western	physical	11336703, 18632848, 18762581, (Europe PMC)	NA	BioGRID
LRP6	Affinity Capture-Western, Far Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	association, physical, physical association	16890161, 19107203, 20128690, 22682247, 23892894, 23959799, 24976009, (Europe PMC)	0.52, 0.53	BioGRID, IntAct
MAP3K1	Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	10829020, 11884395, 20128690, 22682247, 24135036, (Europe PMC)	0.35	BioGRID, IntAct
MAP3K2	Affinity Capture-Western	physical	26884171, (Europe PMC)	NA	BioGRID
MAP3K4	Affinity Capture-Western	physical	17726008, (Europe PMC)	NA	BioGRID
MAPRE1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
MYC	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, direct interaction, physical, physical association	19131971, (Europe PMC)	0.62	BioGRID, IntAct, MINT
MYOT	Two-hybrid, two hybrid array	physical, physical association	21988832, (Europe PMC)	0.37	BioGRID, IntAct
NCK2	Affinity Capture-Western	physical	11557983, (Europe PMC)	NA	BioGRID
PIN1	Affinity Capture-Western, anti tag coimmunoprecipitation	association, physical	19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PML	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	21057547, (Europe PMC)	0.46	BioGRID, IntAct
PPP1CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical, physical association	17318175, (Europe PMC)	0.52	BioGRID, IntAct, MINT
PPP2CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical	17510365, 19131971, 22682247, (Europe PMC)	0.64	BioGRID, IntAct, MINT
PPP2R5A	Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation	association, physical	11297546, 19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PRMT1	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid	physical	21242974, (Europe PMC)	NA	BioGRID
PUF60	Affinity Capture-MS	physical	26496610, (Europe PMC)	NA	BioGRID
SKI	Affinity Capture-Western	physical	21795712, (Europe PMC)	NA	BioGRID
SKIL	Affinity Capture-Western	physical	21795712, (Europe PMC)	NA	BioGRID
SMAD7	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, imaging technique	colocalization, physical, physical association	16601693, 18593713, (Europe PMC)	0.56	BioGRID, IntAct, MINT
SMURF1	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	23959799, 24700460, (Europe PMC)	NA	BioGRID
SMURF2	Affinity Capture-Western, Biochemical Activity	physical	20858899, (Europe PMC)	NA	BioGRID
SMYD2	Affinity Capture-MS, anti bait coimmunoprecipitation	physical, physical association	17353931, (Europe PMC)	0.40	BioGRID, IntAct
STRAP	Affinity Capture-Western	physical	21502811, (Europe PMC)	NA	BioGRID
TNFAIP3	Affinity Capture-Western	physical	23671587, (Europe PMC)	NA	BioGRID
TNKS	Affinity Capture-Western	physical	25547115, (Europe PMC)	NA	BioGRID
TP53	Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	genetic, physical, physical association	21057547, 23826318, (Europe PMC)	0.52	BioGRID, IntAct
TRIM25	Affinity Capture-RNA	physical	29117863, (Europe PMC)	NA	BioGRID
TRIM65	Affinity Capture-Western	physical	28754688, (Europe PMC)	NA	BioGRID
TSC1	Affinity Capture-Western	physical	12511557, (Europe PMC)	NA	BioGRID
TSC2	Affinity Capture-Western	physical	12511557, (Europe PMC)	NA	BioGRID
UBC	Affinity Capture-Western, tandem affinity purification	association, physical	17510365, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
USP15	Affinity Capture-Western	physical	26884171, (Europe PMC)	NA	BioGRID
USP7	Affinity Capture-Western, tandem affinity purification	association, physical	17510365, 29045831, (Europe PMC)	0.35	BioGRID, IntAct
UTP14A	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
WDR26	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17510365, 27098453, (Europe PMC)	0.64	BioGRID, IntAct, MINT
WDYHV1	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
XPO1	Affinity Capture-MS	physical	26673895, (Europe PMC)	NA	BioGRID

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
AMMECR1	anti bait coimmunoprecipitation	physical association	21304492, (Europe PMC)	0.40	IntAct, MINT
ANP32A	Two-hybrid, pull down, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.51	BioGRID, IntAct
APC	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association	17510365, 19131971, 22682247, 26496610, (Europe PMC)	0.35, 0.73	IntAct, MINT
ARHGAP21	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
ARRB1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	19202075, (Europe PMC)	0.50	BioGRID, IntAct
AXIN1	Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, light scattering, molecular sieving, nuclear magnetic resonance, two hybrid pooling approach	direct interaction, physical, physical association	11884395, 16169070, 18632848, 21245303, 23892894, (Europe PMC)	0.40, 0.71	BioGRID, IntAct
AXIN2	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20128690, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
BTRC	Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti bait coimmunoprecipitation	association, physical	10228155, 22682247, 24976009, 25900982, 29045831, (Europe PMC)	0.35	BioGRID, IntAct
CALCOCO2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
CARD9	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
CCDC57	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
CRMP1	Two-hybrid, pull down, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.51	BioGRID, IntAct
CSNK1A1	Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, genetic, physical	11884395, 17510365, 22682247, 26496610, (Europe PMC)	0.64	BioGRID, IntAct
CSNK1D	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CSNK1E	Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, two hybrid	association, colocalization, genetic, physical, physical association	11884395, 21988832, 22682247, 26496610, (Europe PMC)	0.69	BioGRID, IntAct
CTNNA1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CTNNB1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10228155, 12421363, 12805222, 16199882, 16890161, 17318191, 17510365, 18593713, 18632848, 19131971, 19166851, 20128690, 20531388, 21242974, 22509369, 22682247, 22773187, 23892894, 23959799, 24976009, 26496610, 27902311, 29045831, 9734785, (Europe PMC)	0.40, 0.94	BioGRID, IntAct, MINT
DAB2IP	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical association	20080667, (Europe PMC)	0.52	IntAct
DACT1	anti bait coimmunoprecipitation	physical association	22470507, (Europe PMC)	0.40	IntAct
DLG1	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
DVL2	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, nuclear magnetic resonance	association, direct interaction, physical, physical association	10829020, 21245303, 22773187, 23892894, (Europe PMC)	0.40, 0.59	BioGRID, IntAct, MINT
DVL3	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	12805222, 20128690, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
EBI-16429620	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16434222	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16436244	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16436498	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16437007	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EEF1A1	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
EGLN3	anti tag coimmunoprecipitation	association	26972000, (Europe PMC)	0.35	IntAct
FBXW11	Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	22682247, 25332235, 25900982, (Europe PMC)	0.56	BioGRID, IntAct
FRAT1	protein kinase assay, pull down	association, phosphorylation reaction	10481074, (Europe PMC)	0.52	IntAct
GAK	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
GAPVD1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
GID8	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
GOLGA2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
GSK3A	Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17318175, 17510365, 19131971, 23602568, 23959799, 26496610, 26912724, (Europe PMC)	0.35, 0.67	BioGRID, IntAct, MINT
GSK3B	Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, fluorescence polarization spectroscopy, protein kinase assay, proximity ligation assay, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid	association, colocalization, direct interaction, phosphorylation reaction, physical, physical association	10228155, 10481074, 11738041, 12511557, 12584189, 16199882, 16293724, 16890161, 17318175, 17318191, 17510365, 17601533, 18593713, 18632848, 19131971, 19202075, 19303846, 19759537, 20128690, 21242974, 21502811, 21988832, 22270359, 22509369, 22613765, 22682247, 22773187, 23455922, 23602568, 23892894, 23959799, 24451375, 24976009, 25241761, 26496610, 26912724, 29045831, 29568061, 9734785, (Europe PMC)	0.40, 0.97	BioGRID, IntAct, MINT
JUP	Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach, validated two hybrid	association, physical, physical association	26496610, 26871637, (Europe PMC)	0.67	BioGRID, IntAct
KRT40	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
KRTAP4-12	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
KRTAP4-2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
LHX4	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
LMO2	Two-hybrid, confocal microscopy, two hybrid	colocalization, physical, physical association	21988832, (Europe PMC)	0.44	BioGRID, IntAct
LRP6	Affinity Capture-Western, Far Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	association, physical, physical association	16890161, 19107203, 20128690, 22682247, 23892894, 23959799, 24976009, (Europe PMC)	0.52, 0.53	BioGRID, IntAct
MAEA	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
MAP3K1	Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	10829020, 11884395, 20128690, 22682247, 24135036, (Europe PMC)	0.35	BioGRID, IntAct
MAPK3	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
MAPRE1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
MDFI	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
MID2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
MTUS2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
MYC	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, direct interaction, physical, physical association	19131971, (Europe PMC)	0.62	BioGRID, IntAct, MINT
MYOT	Two-hybrid, two hybrid array	physical, physical association	21988832, (Europe PMC)	0.37	BioGRID, IntAct
NIN	anti bait coimmunoprecipitation	association	19390532, (Europe PMC)	0.35	IntAct, MINT
PHF6	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
PIN1	Affinity Capture-Western, anti tag coimmunoprecipitation	association, physical	19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PML	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	21057547, (Europe PMC)	0.46	BioGRID, IntAct
PPM1A	anti bait coimmunoprecipitation	association, physical association	10644691, (Europe PMC)	0.50	IntAct, MINT
PPP1CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical, physical association	17318175, (Europe PMC)	0.52	BioGRID, IntAct, MINT
PPP2CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical	17510365, 19131971, 22682247, (Europe PMC)	0.64	BioGRID, IntAct, MINT
PPP2R1A	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
PPP2R2A	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
PPP2R5A	Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation	association, physical	11297546, 19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PPP2R5C	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
PRMT1	anti bait coimmunoprecipitation, confocal microscopy	association, colocalization	21242974, (Europe PMC)	0.43	IntAct
PSMD2	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
PSMD6	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
PSTPIP1	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
PTBP3	anti bait coimmunoprecipitation	association	22575643, (Europe PMC)	0.35	IntAct, MINT
RANBP10	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
RANBP2	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
RANBP9	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
RNF111	anti bait coimmunoprecipitation	physical association	16601693, (Europe PMC)	0.40	IntAct, MINT
SCYL1	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
SH3GL1	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
SMAD7	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, imaging technique	colocalization, physical, physical association	16601693, 18593713, (Europe PMC)	0.56	BioGRID, IntAct, MINT
SMYD2	Affinity Capture-MS, anti bait coimmunoprecipitation	physical, physical association	17353931, (Europe PMC)	0.40	BioGRID, IntAct
STX11	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
SUMO1	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TFDP1	anti bait coimmunoprecipitation	association	22773187, (Europe PMC)	0.35	IntAct, MINT
TFIP11	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TGIF1	anti bait coimmunoprecipitation	association, physical association	25873176, (Europe PMC)	0.50	IntAct
TNKS2	fluorescence polarization spectroscopy	direct interaction	22153077, (Europe PMC)	0.44	IntAct
TP53	Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	genetic, physical, physical association	21057547, 23826318, (Europe PMC)	0.52	BioGRID, IntAct
TRAF2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIM15	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIM27	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIM29	anti bait coimmunoprecipitation	physical association	19249679, (Europe PMC)	0.40	IntAct
TRIM37	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIP6	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TUBG1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy	association, colocalization	19390532, (Europe PMC)	0.51	IntAct, MINT
UBC	Affinity Capture-Western, tandem affinity purification	association, physical	17510365, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
USP34	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
USP7	Affinity Capture-Western, tandem affinity purification	association, physical	17510365, 29045831, (Europe PMC)	0.35	BioGRID, IntAct
USP9X	anti bait coimmunoprecipitation, tandem affinity purification	association	17510365, 22682247, (Europe PMC)	0.53	IntAct
UTP14A	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
WDR26	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17510365, 27098453, (Europe PMC)	0.64	BioGRID, IntAct, MINT
WWTR1	anti bait coimmunoprecipitation	association	24976009, (Europe PMC)	0.35	IntAct
YAP1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	24976009, (Europe PMC)	0.50	IntAct
YTHDC2	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
ZBTB26	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
ZFYVE19	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
ZNF318	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
APC	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association	17510365, 19131971, 22682247, 26496610, (Europe PMC)	0.35, 0.73	IntAct, MINT
CTNNB1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10228155, 12421363, 12805222, 16199882, 16890161, 17318191, 17510365, 18593713, 18632848, 19131971, 19166851, 20128690, 20531388, 21242974, 22509369, 22682247, 22773187, 23892894, 23959799, 24976009, 26496610, 27902311, 29045831, 9734785, (Europe PMC)	0.40, 0.94	BioGRID, IntAct, MINT
DVL2	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, nuclear magnetic resonance	association, direct interaction, physical, physical association	10829020, 21245303, 22773187, 23892894, (Europe PMC)	0.40, 0.59	BioGRID, IntAct, MINT
GSK3A	Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17318175, 17510365, 19131971, 23602568, 23959799, 26496610, 26912724, (Europe PMC)	0.35, 0.67	BioGRID, IntAct, MINT
GSK3B	Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, fluorescence polarization spectroscopy, protein kinase assay, proximity ligation assay, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid	association, colocalization, direct interaction, phosphorylation reaction, physical, physical association	10228155, 10481074, 11738041, 12511557, 12584189, 16199882, 16293724, 16890161, 17318175, 17318191, 17510365, 17601533, 18593713, 18632848, 19131971, 19202075, 19303846, 19759537, 20128690, 21242974, 21502811, 21988832, 22270359, 22509369, 22613765, 22682247, 22773187, 23455922, 23602568, 23892894, 23959799, 24451375, 24976009, 25241761, 26496610, 26912724, 29045831, 29568061, 9734785, (Europe PMC)	0.40, 0.97	BioGRID, IntAct, MINT
MYC	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, direct interaction, physical, physical association	19131971, (Europe PMC)	0.62	BioGRID, IntAct, MINT
NIN	anti bait coimmunoprecipitation	association	19390532, (Europe PMC)	0.35	IntAct, MINT
PIN1	Affinity Capture-Western, anti tag coimmunoprecipitation	association, physical	19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PPM1A	anti bait coimmunoprecipitation	association, physical association	10644691, (Europe PMC)	0.50	IntAct, MINT
PPP1CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical, physical association	17318175, (Europe PMC)	0.52	BioGRID, IntAct, MINT
PPP2CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical	17510365, 19131971, 22682247, (Europe PMC)	0.64	BioGRID, IntAct, MINT
PPP2R5A	Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation	association, physical	11297546, 19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PTBP3	anti bait coimmunoprecipitation	association	22575643, (Europe PMC)	0.35	IntAct, MINT
RNF111	anti bait coimmunoprecipitation	physical association	16601693, (Europe PMC)	0.40	IntAct, MINT
SMAD7	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, imaging technique	colocalization, physical, physical association	16601693, 18593713, (Europe PMC)	0.56	BioGRID, IntAct, MINT
TFDP1	anti bait coimmunoprecipitation	association	22773187, (Europe PMC)	0.35	IntAct, MINT
TUBG1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy	association, colocalization	19390532, (Europe PMC)	0.51	IntAct, MINT
WDR26	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17510365, 27098453, (Europe PMC)	0.64	BioGRID, IntAct, MINT

Visualize Download

Interacting partner	Detection method	Interaction type	PubMed IDs	Interaction Score	Source
AMMECR1	anti bait coimmunoprecipitation	physical association	21304492, (Europe PMC)	0.40	IntAct, MINT
ANP32A	Two-hybrid, pull down, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.51	BioGRID, IntAct
APC	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid	physical	10228155, 16199882, 20128690, 22682247, 23277359, 26496610, 29045831, 9734785, (Europe PMC)	NA	BioGRID
APC	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association	17510365, 19131971, 22682247, 26496610, (Europe PMC)	0.35, 0.73	IntAct, MINT
ARHGAP21	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
ARRB1	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical, physical association	19202075, (Europe PMC)	0.50	BioGRID, IntAct
AXIN1	Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, light scattering, molecular sieving, nuclear magnetic resonance, two hybrid pooling approach	direct interaction, physical, physical association	11884395, 16169070, 18632848, 21245303, 23892894, (Europe PMC)	0.40, 0.71	BioGRID, IntAct
AXIN2	Affinity Capture-MS, anti bait coimmunoprecipitation	association, physical	20128690, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
BTRC	Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti bait coimmunoprecipitation	association, physical	10228155, 22682247, 24976009, 25900982, 29045831, (Europe PMC)	0.35	BioGRID, IntAct
CALCOCO2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
CARD9	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
CARM1	Biochemical Activity	physical	21242974, (Europe PMC)	NA	BioGRID
CAV1	Affinity Capture-Western	physical	16890161, (Europe PMC)	NA	BioGRID
CCDC57	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
CRMP1	Two-hybrid, pull down, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.51	BioGRID, IntAct
CSNK1A1	Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, genetic, physical	11884395, 17510365, 22682247, 26496610, (Europe PMC)	0.64	BioGRID, IntAct
CSNK1D	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CSNK1E	Affinity Capture-MS, Affinity Capture-Western, Phenotypic Suppression, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, two hybrid	association, colocalization, genetic, physical, physical association	11884395, 21988832, 22682247, 26496610, (Europe PMC)	0.69	BioGRID, IntAct
CTNNA1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
CTNNB1	Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	10228155, 12421363, 12805222, 16199882, 16890161, 17318191, 17510365, 18593713, 18632848, 19131971, 19166851, 20128690, 20531388, 21242974, 22509369, 22682247, 22773187, 23892894, 23959799, 24976009, 26496610, 27902311, 29045831, 9734785, (Europe PMC)	0.40, 0.94	BioGRID, IntAct, MINT
DAB2	Reconstituted Complex	physical	12805222, (Europe PMC)	NA	BioGRID
DAB2IP	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical association	20080667, (Europe PMC)	0.52	IntAct
DACT1	anti bait coimmunoprecipitation	physical association	22470507, (Europe PMC)	0.40	IntAct
DAXX	Affinity Capture-Western, Two-hybrid	physical	17210684, (Europe PMC)	NA	BioGRID
DLG1	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
DVL1	Affinity Capture-Western	physical	10428961, 18632848, (Europe PMC)	NA	BioGRID
DVL2	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, nuclear magnetic resonance	association, direct interaction, physical, physical association	10829020, 21245303, 22773187, 23892894, (Europe PMC)	0.40, 0.59	BioGRID, IntAct, MINT
DVL3	Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	12805222, 20128690, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
EBI-16429620	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16434222	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16436244	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16436498	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EBI-16437007	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
EEF1A1	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
EGLN3	anti tag coimmunoprecipitation	association	26972000, (Europe PMC)	0.35	IntAct
FBXW11	Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical, physical association	22682247, 25332235, 25900982, (Europe PMC)	0.56	BioGRID, IntAct
FOXM1	Affinity Capture-Western	physical	26912724, (Europe PMC)	NA	BioGRID
FRAT1	protein kinase assay, pull down	association, phosphorylation reaction	10481074, (Europe PMC)	0.52	IntAct
GAK	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
GAPVD1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
GID8	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
GNAS	Affinity Capture-Western, Reconstituted Complex	physical	16293724, (Europe PMC)	NA	BioGRID
GOLGA2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
GSK3A	Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17318175, 17510365, 19131971, 23602568, 23959799, 26496610, 26912724, (Europe PMC)	0.35, 0.67	BioGRID, IntAct, MINT
GSK3B	Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, fluorescence polarization spectroscopy, protein kinase assay, proximity ligation assay, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid	association, colocalization, direct interaction, phosphorylation reaction, physical, physical association	10228155, 10481074, 11738041, 12511557, 12584189, 16199882, 16293724, 16890161, 17318175, 17318191, 17510365, 17601533, 18593713, 18632848, 19131971, 19202075, 19303846, 19759537, 20128690, 21242974, 21502811, 21988832, 22270359, 22509369, 22613765, 22682247, 22773187, 23455922, 23602568, 23892894, 23959799, 24451375, 24976009, 25241761, 26496610, 26912724, 29045831, 29568061, 9734785, (Europe PMC)	0.40, 0.97	BioGRID, IntAct, MINT
HIPK2	Affinity Capture-Western	physical	21057547, 23826318, (Europe PMC)	NA	BioGRID
HTT	Affinity Capture-Western	physical	20531388, (Europe PMC)	NA	BioGRID
JUP	Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach, validated two hybrid	association, physical, physical association	26496610, 26871637, (Europe PMC)	0.67	BioGRID, IntAct
KRT40	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
KRTAP4-12	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
KRTAP4-2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
LHX4	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
LMO2	Two-hybrid, confocal microscopy, two hybrid	colocalization, physical, physical association	21988832, (Europe PMC)	0.44	BioGRID, IntAct
LRP5	Affinity Capture-Western	physical	11336703, 18632848, 18762581, (Europe PMC)	NA	BioGRID
LRP6	Affinity Capture-Western, Far Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down	association, physical, physical association	16890161, 19107203, 20128690, 22682247, 23892894, 23959799, 24976009, (Europe PMC)	0.52, 0.53	BioGRID, IntAct
MAEA	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
MAP3K1	Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation	association, physical	10829020, 11884395, 20128690, 22682247, 24135036, (Europe PMC)	0.35	BioGRID, IntAct
MAP3K2	Affinity Capture-Western	physical	26884171, (Europe PMC)	NA	BioGRID
MAP3K4	Affinity Capture-Western	physical	17726008, (Europe PMC)	NA	BioGRID
MAPK3	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
MAPRE1	Affinity Capture-MS, anti tag coimmunoprecipitation	association, physical	26496610, (Europe PMC)	0.35	BioGRID, IntAct
MDFI	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
MID2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
MTUS2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
MYC	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, direct interaction, physical, physical association	19131971, (Europe PMC)	0.62	BioGRID, IntAct, MINT
MYOT	Two-hybrid, two hybrid array	physical, physical association	21988832, (Europe PMC)	0.37	BioGRID, IntAct
NCK2	Affinity Capture-Western	physical	11557983, (Europe PMC)	NA	BioGRID
NIN	anti bait coimmunoprecipitation	association	19390532, (Europe PMC)	0.35	IntAct, MINT
PHF6	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
PIN1	Affinity Capture-Western, anti tag coimmunoprecipitation	association, physical	19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PML	Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy	colocalization, physical, physical association	21057547, (Europe PMC)	0.46	BioGRID, IntAct
PPM1A	anti bait coimmunoprecipitation	association, physical association	10644691, (Europe PMC)	0.50	IntAct, MINT
PPP1CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	physical, physical association	17318175, (Europe PMC)	0.52	BioGRID, IntAct, MINT
PPP2CA	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical	17510365, 19131971, 22682247, (Europe PMC)	0.64	BioGRID, IntAct, MINT
PPP2R1A	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
PPP2R2A	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
PPP2R5A	Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation	association, physical	11297546, 19131971, (Europe PMC)	0.35	BioGRID, IntAct, MINT
PPP2R5C	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
PRMT1	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid	physical	21242974, (Europe PMC)	NA	BioGRID
PRMT1	anti bait coimmunoprecipitation, confocal microscopy	association, colocalization	21242974, (Europe PMC)	0.43	IntAct
PSMD2	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
PSMD6	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
PSTPIP1	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
PTBP3	anti bait coimmunoprecipitation	association	22575643, (Europe PMC)	0.35	IntAct, MINT
PUF60	Affinity Capture-MS	physical	26496610, (Europe PMC)	NA	BioGRID
RANBP10	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
RANBP2	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
RANBP9	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
RNF111	anti bait coimmunoprecipitation	physical association	16601693, (Europe PMC)	0.40	IntAct, MINT
SCYL1	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
SH3GL1	two hybrid pooling approach	physical association	16169070, (Europe PMC)	0.37	IntAct
SKI	Affinity Capture-Western	physical	21795712, (Europe PMC)	NA	BioGRID
SKIL	Affinity Capture-Western	physical	21795712, (Europe PMC)	NA	BioGRID
SMAD7	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, imaging technique	colocalization, physical, physical association	16601693, 18593713, (Europe PMC)	0.56	BioGRID, IntAct, MINT
SMURF1	Affinity Capture-Western, Biochemical Activity, Reconstituted Complex	physical	23959799, 24700460, (Europe PMC)	NA	BioGRID
SMURF2	Affinity Capture-Western, Biochemical Activity	physical	20858899, (Europe PMC)	NA	BioGRID
SMYD2	Affinity Capture-MS, anti bait coimmunoprecipitation	physical, physical association	17353931, (Europe PMC)	0.40	BioGRID, IntAct
STRAP	Affinity Capture-Western	physical	21502811, (Europe PMC)	NA	BioGRID
STX11	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
SUMO1	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TFDP1	anti bait coimmunoprecipitation	association	22773187, (Europe PMC)	0.35	IntAct, MINT
TFIP11	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TGIF1	anti bait coimmunoprecipitation	association, physical association	25873176, (Europe PMC)	0.50	IntAct
TNFAIP3	Affinity Capture-Western	physical	23671587, (Europe PMC)	NA	BioGRID
TNKS	Affinity Capture-Western	physical	25547115, (Europe PMC)	NA	BioGRID
TNKS2	fluorescence polarization spectroscopy	direct interaction	22153077, (Europe PMC)	0.44	IntAct
TP53	Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	genetic, physical, physical association	21057547, 23826318, (Europe PMC)	0.52	BioGRID, IntAct
TRAF2	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIM15	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIM25	Affinity Capture-RNA	physical	29117863, (Europe PMC)	NA	BioGRID
TRIM27	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIM29	anti bait coimmunoprecipitation	physical association	19249679, (Europe PMC)	0.40	IntAct
TRIM37	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TRIM65	Affinity Capture-Western	physical	28754688, (Europe PMC)	NA	BioGRID
TRIP6	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
TSC1	Affinity Capture-Western	physical	12511557, (Europe PMC)	NA	BioGRID
TSC2	Affinity Capture-Western	physical	12511557, (Europe PMC)	NA	BioGRID
TUBG1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy	association, colocalization	19390532, (Europe PMC)	0.51	IntAct, MINT
UBC	Affinity Capture-Western, tandem affinity purification	association, physical	17510365, 22682247, (Europe PMC)	0.35	BioGRID, IntAct
USP15	Affinity Capture-Western	physical	26884171, (Europe PMC)	NA	BioGRID
USP34	tandem affinity purification	association	17510365, (Europe PMC)	0.35	IntAct
USP7	Affinity Capture-Western, tandem affinity purification	association, physical	17510365, 29045831, (Europe PMC)	0.35	BioGRID, IntAct
USP9X	anti bait coimmunoprecipitation, tandem affinity purification	association	17510365, 22682247, (Europe PMC)	0.53	IntAct
UTP14A	Two-hybrid, two hybrid pooling approach	physical, physical association	16169070, (Europe PMC)	0.37	BioGRID, IntAct
WDR26	Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification	association, physical, physical association	17510365, 27098453, (Europe PMC)	0.64	BioGRID, IntAct, MINT
WDYHV1	Affinity Capture-MS	physical	28514442, (Europe PMC)	NA	BioGRID
WWTR1	anti bait coimmunoprecipitation	association	24976009, (Europe PMC)	0.35	IntAct
XPO1	Affinity Capture-MS	physical	26673895, (Europe PMC)	NA	BioGRID
YAP1	anti bait coimmunoprecipitation, anti tag coimmunoprecipitation	association, physical association	24976009, (Europe PMC)	0.50	IntAct
YTHDC2	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct
ZBTB26	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
ZFYVE19	two hybrid array, two hybrid prey pooling approach, validated two hybrid	physical association	26871637, (Europe PMC)	0.56	IntAct
ZNF318	anti bait coimmunoprecipitation	association	22682247, (Europe PMC)	0.35	IntAct

Top

AXIN1