Top
SSH1
Localization (UniProt annotation) Cytoplasm, cytoskeleton Cell projection,lamellipodium Cleavage furrow Midbody Note=Also recruited toactin rich membrane protrusions such as lamellipodia, which mayallow local control of actin dynamics at sites of cell locomotionAlso localized to the cleavage furrow and the midbody duringcytokinesis Function (UniProt annotation) Protein phosphatase which regulates actin filamentdynamics Dephosphorylates and activates the actinbinding/depolymerizing factor cofilin, which subsequently binds toactin filaments and stimulates their disassembly Inhibitoryphosphorylation of cofilin is mediated by LIMK1, which may also bedephosphorylated and inactivated by this protein Catalytic Activity (UniProt annotation) Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate Protein Sequence MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLPQHLQV
MINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFS
VSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPAL
FVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEMLLILGQMDKPSLIFDHLYLGS
EWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRS
ASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFL
PETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEVHRPARQPQQG
SGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGRWGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILN
KVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGS
RRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKP
TTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSD
EKSEAAPASLEGGSLKSPPPFFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIET
RLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENL
KSPSWMSKS
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
SSH1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04360 Axon guidance Axon guidance represents a key stage in the formation of neuronal network. Axons are guided by a variety of guidance factors, such as netrins, ephrins, Slits, and semaphorins. These guidance cues are read by growth cone receptors, and signal transduction pathways downstream of these receptors converge onto the Rho GTPases to elicit changes in cytoskeletal organization that determine which way the growth cone will turn. hsa04810 Regulation of actin cytoskeleton
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTB Affinity Capture-MS, Reconstituted Complex physical 11832213 , 28514442 , (Europe PMC )NA BioGRID ACTBL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ACTN4 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ATF1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CCT8L1P Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CORO1C Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DSTN Biochemical Activity physical 11832213 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ERBB2 Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS physical 25515538 , (Europe PMC )NA BioGRID GSN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IGF1R Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID INSR Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID KIAA1671 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MYH10 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1D Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MYO5A Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MYO5B Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SCIN Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SSH1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SVIL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TMOD2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMOD3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, coimmunoprecipitation association, physical 15159416 , 19329994 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 27432908 , 28514442 , (Europe PMC )NA BioGRID YWHAH Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS, coimmunoprecipitation, pull down association, direct interaction, physical 15660133 , 19371722 , 27432908 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, coimmunoprecipitation association, physical 19371722 , 27432908 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARPC2 anti tag coimmunoprecipitation association 17350576 , (Europe PMC )0.35 IntAct CBX1 tandem affinity purification association 21888893 , (Europe PMC )0.35 IntAct CFL1 pull down physical association 21525957 , (Europe PMC )0.40 IntAct, MINT CORO1B anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, phosphatase assay association, dephosphorylation reaction 17350576 , (Europe PMC )0.58 IntAct LIMK1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, imaging technique, phosphatase assay, pull down colocalization, dephosphorylation reaction, direct interaction, physical association 15660133 , (Europe PMC )0.40, 0.68 IntAct, MINT MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAB Affinity Capture-MS, coimmunoprecipitation association, physical 15159416 , 19329994 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, coimmunoprecipitation, pull down association, direct interaction, physical 15660133 , 19371722 , 27432908 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, coimmunoprecipitation association, physical 19371722 , 27432908 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CFL1 pull down physical association 21525957 , (Europe PMC )0.40 IntAct, MINT LIMK1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, imaging technique, phosphatase assay, pull down colocalization, dephosphorylation reaction, direct interaction, physical association 15660133 , (Europe PMC )0.40, 0.68 IntAct, MINT YWHAB Affinity Capture-MS, coimmunoprecipitation association, physical 15159416 , 19329994 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, coimmunoprecipitation, pull down association, direct interaction, physical 15660133 , 19371722 , 27432908 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, coimmunoprecipitation association, physical 19371722 , 27432908 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTA2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS, Reconstituted Complex physical 11832213 , 28514442 , (Europe PMC )NA BioGRID ACTBL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ACTN4 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ARPC2 anti tag coimmunoprecipitation association 17350576 , (Europe PMC )0.35 IntAct ATF1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CBX1 tandem affinity purification association 21888893 , (Europe PMC )0.35 IntAct CCT8L1P Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CFL1 pull down physical association 21525957 , (Europe PMC )0.40 IntAct, MINT CORO1B anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, phosphatase assay association, dephosphorylation reaction 17350576 , (Europe PMC )0.58 IntAct CORO1C Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DSTN Biochemical Activity physical 11832213 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ERBB2 Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-MS physical 25515538 , (Europe PMC )NA BioGRID GSN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IGF1R Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID INSR Affinity Capture-Western physical 28065597 , (Europe PMC )NA BioGRID KIAA1671 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID LIMK1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, imaging technique, phosphatase assay, pull down colocalization, dephosphorylation reaction, direct interaction, physical association 15660133 , (Europe PMC )0.40, 0.68 IntAct, MINT MYH10 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1D Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MYO5A Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MYO5B Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SCIN Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SSH1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID SVIL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TMOD2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMOD3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, coimmunoprecipitation association, physical 15159416 , 19329994 , 27432908 , (Europe PMC )0.53 BioGRID, IntAct, MINT YWHAE Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 27432908 , 28514442 , (Europe PMC )NA BioGRID YWHAH Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS, coimmunoprecipitation, pull down association, direct interaction, physical 15660133 , 19371722 , 27432908 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, coimmunoprecipitation association, physical 19371722 , 27432908 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT1 T826_AGLVRKHtKELERLK , NA NA PhosphoSitePlus , PRKD1 S402_MGVSRSAsTVIAYAM , S937_SNLTRSSsSDSIHSV , S978_SPLKRSHsLAKLGSL , NA NA PhosphoSitePlus , PRKD2 S937_SNLTRSSsSDSIHSV , S978_SPLKRSHsLAKLGSL , NA NA PhosphoSitePlus , Unknown S1042_PAPENLKsPSWMSKS , S37_EDRKLNLsLSESFFM , S515_PCCFRRLsDPLLPSP , S576_KKKLEFGsPKGRSGS , S57_LFLQQGSsPQGQRSL , S937_SNLTRSSsSDSIHSV , S971_LAGLTVSsPLKRSHS , S976_VSSPLKRsHSLAKLG , S978_SPLKRSHsLAKLGSL , T5_MALVtLQRSPTP , HTP, LTP, in vivo 15159416 , 15302935 , 18669648 , 20058876 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,