Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
SKAP2
Gene Name  | SKAP2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3OMH |
| Synonyms | SKAP2, PRAP, RA70, SAPS, SCAP2, SKAP55R, | |
| Protein Name | SKAP2 | |
| Alternative Name(s) | Src kinase-associated phosphoprotein 2;Pyk2/RAFTK-associated protein;Retinoic acid-induced protein 70;SKAP55 homolog;SKAP-55HOM;SKAP-HOM;Src family-associated phosphoprotein 2;Src kinase-associated phosphoprotein 55-related protein;Src-associated adapter protein with PH and SH3 domains; | |
| Protein Family | Belongs to the SKAP family | |
| EntrezGene ID | 8935 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O75563 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 41217 Dalton | |
| Protein Length | 359 amino acids (AA) | |
| Genome Browsers | NCBI | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| May be involved in B-cell and macrophage adhesionprocesses In B-cells, may act by coupling the B-cell receptor(BCR) to integrin activation May play a role in src signalingpathway | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFA GPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQ KGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDV DHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKR GDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0002757 | P:immune response-activating signal transduction |
| GO:0005070 | F:SH3/SH2 adaptor activity |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0007165 | P:signal transduction |
| GO:0008285 | P:negative regulation of cell proliferation |
| GO:0042113 | P:B cell activation |
| GO:0065003 | P:protein-containing complex assembly |
