- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PTK2
Gene Name  | PTK2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 4K9Y |
| Synonyms | PTK2, FAK, FAK1 | |
| Protein Name | PTK2 | |
| Alternative Name(s) | Focal adhesion kinase 1;FADK 1;2.7.10.2;Focal adhesion kinase-related nonkinase;FRNK;Protein phosphatase 1 regulatory subunit 71;PPP1R71;Protein-tyrosine kinase 2;p125FAK;pp125FAK; | |
| Protein Family | Belongs to the protein kinase superfamily Tyr proteinkinase family FAK subfamily | |
| EntrezGene ID | 5747 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q05397 (protein sequence) | |
| Enzyme Class | 2.7.10.2 (BRENDA ) | |
| Molecular Weight | 119233 Dalton | |
| Protein Length | 1052 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000169398 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG4257 | eggNOG - ENOG410ZH9Y | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cell junction, focal adhesion Cellmembrane; Peripheral membrane protein; Cytoplasmic sideCytoplasm, cell cortex Cytoplasm, cytoskeleton Cytoplasm,cytoskeleton, microtubule organizing center, centrosome Nucleus Note=Constituent of focal adhesionsDetected at microtubules | |||
| Function (UniProt annotation) | |||
| Non-receptor protein-tyrosine kinase that plays anessential role in regulating cell migration, adhesion, spreading,reorganization of the actin cytoskeleton, formation anddisassembly of focal adhesions and cell protrusions, cell cycleprogression, cell proliferation and apoptosis Required for earlyembryonic development and placenta development Required forembryonic angiogenesis, normal cardiomyocyte migration andproliferation, and normal heart development Regulates axon growthand neuronal cell migration, axon branching and synapse formation;required for normal development of the nervous system Plays arole in osteogenesis and differentiation of osteoblasts Functionsin integrin signal transduction, but also in signaling downstreamof numerous growth factor receptors, G-protein coupled receptors(GPCR), EPHA2, netrin receptors and LDL receptors Formsmultisubunit signaling complexes with SRC and SRC family membersupon activation; this leads to the phosphorylation of additionaltyrosine residues, creating binding sites for scaffold proteins,effectors and substrates Regulates numerous signaling pathwaysPromotes activation of phosphatidylinositol 3-kinase and the AKT1signaling cascade Promotes activation of MAPK1/ERK2, MAPK3/ERK1and the MAP kinase signaling cascade Promotes localized andtransient activation of guanine nucleotide exchange factors (GEFs)and GTPase-activating proteins (GAPs), and thereby modulates theactivity of Rho family GTPases Signaling via CAS family membersmediates activation of RAC1 Recruits the ubiquitin ligase MDM2 toP53/TP53 in the nucleus, and thereby regulates P53/TP53 activity,P53/TP53 ubiquitination and proteasomal degradationPhosphorylates SRC; this increases SRC kinase activityPhosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL Promotesphosphorylation of PXN and STAT1; most likely PXN and STAT1 arephosphorylated by a SRC family kinase that is recruited toautophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itselfPromotes phosphorylation of BCAR1; GIT2 and SHC1; this requiresboth SRC and PTK2/FAK1 Promotes phosphorylation of BMX andPIK3R1 Isoform 6 (FRNK) does not contain a kinase domain andinhibits PTK2/FAK1 phosphorylation and signaling Its enhancedexpression can attenuate the nuclear accumulation of LPXN andlimit its ability to enhance serum response factor (SRF)-dependentgene transcription | |||
| Catalytic Activity (UniProt annotation) | |||
| ATP + a [protein]-L-tyrosine = ADP + a[protein]-L-tyrosine phosphate | |||
| Protein Sequence | |||
| MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHV ACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIA DQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKI AGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEI IDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCV KLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGER LPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIG QVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPG APGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQ ARLKMLGQTRPH | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| DOC_WW_Pin1_4 | 907-QEISPP-912 | WW domain ligands | ...([ST])P. | LIG_SH2_SRC | 397-YAEI-400 | SH2 ligand | (Y)[QDEVAIL][DENPYHI][IPVGAHS] | LIG_SH3_2 | 712-PPKPSR-717 | SH3 ligand | P..P.[KR] | MOD_ProDKin_1 | 907-QEISPPP-913 | MAPK Phosphorylation Site | ...([ST])P.. |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000165 | P:MAPK cascade |
| GO:0000226 | P:microtubule cytoskeleton organization |
| GO:0001525 | P:angiogenesis |
| GO:0001570 | P:vasculogenesis |
| GO:0001725 | C:stress fiber |
| GO:0001764 | P:neuron migration |
| GO:0001890 | P:placenta development |
| GO:0001932 | P:regulation of protein phosphorylation |
| GO:0001934 | P:positive regulation of protein phosphorylation |
| GO:0003007 | P:heart morphogenesis |
| GO:0003779 | F:actin binding |
| GO:0004672 | F:protein kinase activity |
| GO:0004713 | F:protein tyrosine kinase activity |
| GO:0004715 | F:non-membrane spanning protein tyrosine kinase activity |
| GO:0005088 | F:Ras guanyl-nucleotide exchange factor activity |
| GO:0005102 | F:signaling receptor binding |
| GO:0005524 | F:ATP binding |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005815 | C:microtubule organizing center |
| GO:0005829 | C:cytosol |
| GO:0005856 | C:cytoskeleton |
| GO:0005886 | C:plasma membrane |
| GO:0005925 | C:focal adhesion |
| GO:0005938 | C:cell cortex |
| GO:0007097 | P:nuclear migration |
| GO:0007172 | P:signal complex assembly |
| GO:0007173 | P:epidermal growth factor receptor signaling pathway |
| GO:0007179 | P:transforming growth factor beta receptor signaling pathway |
| GO:0007229 | P:integrin-mediated signaling pathway |
| GO:0007411 | P:axon guidance |
| GO:0008284 | P:positive regulation of cell proliferation |
| GO:0008360 | P:regulation of cell shape |
| GO:0008432 | F:JUN kinase binding |
| GO:0010507 | P:negative regulation of autophagy |
| GO:0010594 | P:regulation of endothelial cell migration |
| GO:0010613 | P:positive regulation of cardiac muscle hypertrophy |
| GO:0010632 | P:regulation of epithelial cell migration |
| GO:0014068 | P:positive regulation of phosphatidylinositol 3-kinase signaling |
| GO:0016324 | C:apical plasma membrane |
| GO:0018108 | P:peptidyl-tyrosine phosphorylation |
| GO:0019901 | F:protein kinase binding |
| GO:0019903 | F:protein phosphatase binding |
| GO:0021955 | P:central nervous system neuron axonogenesis |
| GO:0022408 | P:negative regulation of cell-cell adhesion |
| GO:0030010 | P:establishment of cell polarity |
| GO:0030027 | C:lamellipodium |
| GO:0030198 | P:extracellular matrix organization |
| GO:0030335 | P:positive regulation of cell migration |
| GO:0031234 | C:extrinsic component of cytoplasmic side of plasma membrane |
| GO:0033628 | P:regulation of cell adhesion mediated by integrin |
| GO:0038007 | P:netrin-activated signaling pathway |
| GO:0038083 | P:peptidyl-tyrosine autophosphorylation |
| GO:0038096 | P:Fc-gamma receptor signaling pathway involved in phagocytosis |
| GO:0042127 | P:regulation of cell proliferation |
| GO:0042169 | F:SH2 domain binding |
| GO:0043066 | P:negative regulation of apoptotic process |
| GO:0043087 | P:regulation of GTPase activity |
| GO:0043542 | P:endothelial cell migration |
| GO:0043552 | P:positive regulation of phosphatidylinositol 3-kinase activity |
| GO:0045087 | P:innate immune response |
| GO:0045667 | P:regulation of osteoblast differentiation |
| GO:0045860 | P:positive regulation of protein kinase activity |
| GO:0046621 | P:negative regulation of organ growth |
| GO:0046777 | P:protein autophosphorylation |
| GO:0048010 | P:vascular endothelial growth factor receptor signaling pathway |
| GO:0048013 | P:ephrin receptor signaling pathway |
| GO:0048870 | P:cell motility |
| GO:0050771 | P:negative regulation of axonogenesis |
| GO:0051493 | P:regulation of cytoskeleton organization |
| GO:0051893 | P:regulation of focal adhesion assembly |
| GO:0051897 | P:positive regulation of protein kinase B signaling |
| GO:0051964 | P:negative regulation of synapse assembly |
| GO:0060396 | P:growth hormone receptor signaling pathway |
| GO:1900024 | P:regulation of substrate adhesion-dependent cell spreading |
| GO:2000060 | P:positive regulation of ubiquitin-dependent protein catabolic process |
| GO:2000811 | P:negative regulation of anoikis |
PTK2 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in PTK2 (Q05397) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| ACP1 | P24666 | NA | In vitro and in vivo | 12055185, | Europe PMC |  |
| PTEN | P60484 | Tyr-397_SETDDyAEIID, | In vitro and in vivo | 10400703, 9616126, 10427092, | Europe PMC | |
| PTPN1 | P18031 | Tyr-397_SETDDyAEIID, | In vivo | 16291744, 9418872, | Europe PMC | |
| PTPN12 | Q05209 | Tyr-397 _SETDDyAEIID, | In vitro and in vivo | 19595712, | Europe PMC | |
| PTPN23 | Q9H3S7 | NA | In vivo | 17959146, | Europe PMC | |
| PPP1CA | P62136 | Ser-722_RPGYPsPRSSE, | In vitro | 15975092, 11513739, | Europe PMC | |
| PPP1CB | P62140 | Ser-722_RPGYPsPRSSE, | In vitro | 15975092, 11513739, | Europe PMC | |
| PPP1CC | P36873 | Ser-722_RPGYPsPRSSE, | In vitro | 15975092, 11513739, | Europe PMC | |
| UBASH3B | Q8TF42 | NA | N/A | UniProt, | Europe PMC | N/A |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa01522 | Endocrine resistance | Endocrine therapy is a key treatment strategy to control or eradicate hormone-responsive breast cancer. The most commonly used endocrine therapy agents are selective estrogen receptor modulators (SERMs, e.g. tamoxifen), estrogen synthesis inhibitors (e.g. aromatase inhibitors (AIs) such as anastrozole, letrozole, and exemestane), and selective estrogen receptor down-regulators (SERDs, e.g. fulvestrant). However, resistance to these agents has become a major clinical obstacle. Mechanisms of endocrine resistance include loss of ER-alpha expression, altered expression of coactivators or coregulators that play a critical role in ER-mediated gene transcription, ligand-independent growth factor signaling cascades that activate kinases and ER-phosphorylation, altered availability of active tamoxifen metabolites regulated by drug-metabolizing enzymes, such as CYP2D6, and deregulation of the cell cycle and apoptotic machinery. |
| hsa04012 | ErbB signaling pathway | The ErbB family of receptor tyrosine kinases (RTKs) couples binding of extracellular growth factor ligands to intracellular signaling pathways regulating diverse biologic responses, including proliferation, differentiation, cell motility, and survival. Ligand binding to the four closely related members of this RTK family -epidermal growth factor receptor (EGFR, also known as ErbB-1 or HER1), ErbB-2 (HER2), ErbB-3 (HER3), and ErbB-4 (HER4)-induces the formation of receptor homo- and heterodimers and the activation of the intrinsic kinase domain, resulting in phosphorylation on specific tyrosine residues (pY) within the cytoplasmic tail. Signaling effectors containing binding pockets for pY-containing peptides are recruited to activated receptors and induce the various signaling pathways. The Shc- and/or Grb2-activated mitogen-activated protein kinase (MAPK) pathway is a common target downstream of all ErbB receptors. Similarly, the phosphatidylinositol-3-kinase (PI-3K) pathway is directly or indirectly activated by most ErbBs. Several cytoplasmic docking proteins appear to be recruited by specific ErbB receptors and less exploited by others. These include the adaptors Crk, Nck, the phospholipase C gamma (PLCgamma), the intracellular tyrosine kinase Src, or the Cbl E3 ubiquitin protein ligase. |
| hsa04062 | Chemokine signaling pathway | Inflammatory immune response requires the recruitment of leukocytes to the site of inflammation upon foreign insult. Chemokines are small chemoattractant peptides that provide directional cues for the cell trafficking and thus are vital for protective host response. In addition, chemokines regulate plethora of biological processes of hematopoietic cells to lead cellular activation, differentiation and survival.The chemokine signal is transduced by chemokine receptors (G-protein coupled receptors) expressed on the immune cells. After receptor activation, the alpha- and beta-gamma-subunits of G protein dissociate to activate diverse downstream pathways resulting in cellular polarization and actin reorganization. Various members of small GTPases are involved in this process. Induction of nitric oxide and production of reactive oxygen species are as well regulated by chemokine signal via calcium mobilization and diacylglycerol production. |
| hsa04151 | PI3K-Akt signaling pathway | The phosphatidylinositol 3' -kinase(PI3K)-Akt signaling pathway is activated by many types of cellular stimuli or toxic insults and regulates fundamental cellular functions such as transcription, translation, proliferation, growth, and survival. The binding of growth factors to their receptor tyrosine kinase (RTK) or G protein-coupled receptors (GPCR) stimulates class Ia and Ib PI3K isoforms, respectively. PI3K catalyzes the production of phosphatidylinositol-3,4,5-triphosphate (PIP3) at the cell membrane. PIP3 in turn serves as a second messenger that helps to activate Akt. Once active, Akt can control key cellular processes by phosphorylating substrates involved in apoptosis, protein synthesis, metabolism, and cell cycle. |
| hsa04360 | Axon guidance | Axon guidance represents a key stage in the formation of neuronal network. Axons are guided by a variety of guidance factors, such as netrins, ephrins, Slits, and semaphorins. These guidance cues are read by growth cone receptors, and signal transduction pathways downstream of these receptors converge onto the Rho GTPases to elicit changes in cytoskeletal organization that determine which way the growth cone will turn. |
| hsa04370 | VEGF signaling pathway | There is now much evidence that VEGFR-2 is the major mediator of VEGF-driven responses in endothelial cells and it is considered to be a crucial signal transducer in both physiologic and pathologic angiogenesis. The binding of VEGF to VEGFR-2 leads to a cascade of different signaling pathways, resulting in the up-regulation of genes involved in mediating the proliferation and migration of endothelial cells and promoting their survival and vascular permeability. For example, the binding of VEGF to VEGFR-2 leads to dimerization of the receptor, followed by intracellular activation of the PLCgamma;PKC-Raf kinase-MEK-mitogen-activated protein kinase (MAPK) pathway and subsequent initiation of DNA synthesis and cell growth, whereas activation of the phosphatidylinositol 3' -kinase (PI3K)-Akt pathway leads to increased endothelial-cell survival. Activation of PI3K, FAK, and p38 MAPK is implicated in cell migration signaling. |
| hsa04510 | Focal adhesion | Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. |
| hsa04670 | Leukocyte transendothelial migration | Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion. |
| hsa04810 | Regulation of actin cytoskeleton | |
| hsa05100 | Bacterial invasion of epithelial cells | Many pathogenic bacteria can invade phagocytic and non-phagocytic cells and colonize them intracellularly, then become disseminated to other cells. Invasive bacteria induce their own uptake by non-phagocytic host cells (e.g. epithelial cells) using two mechanisms referred to as zipper model and trigger model. Listeria, Staphylococcus, Streptococcus, and Yersinia are examples of bacteria that enter using the zipper model. These bacteria express proteins on their surfaces that interact with cellular receptors, initiating signalling cascades that result in close apposition of the cellular membrane around the entering bacteria. Shigella and Salmonella are the examples of bacteria entering cells using the trigger model. These bacteria use type III secretion systems to inject protein effectors that interact with the actin cytoskeleton. |
| hsa05146 | Amoebiasis | Entamoeba histolytica, an extracellular protozoan parasite is a human pathogen that invades the intestinal epithelium. Infection occurs on ingestion of contaminated water and food. The pathogenesis of amoebiasis begins with parasite attachment and disruption of the intestinal mucus layer, followed by apoptosis of host epithelial cells. Intestinal tissue destruction causes severe dysentery and ulcerations in amoebic colitis. Several amoebic proteins such as lectins, cysteine proteineases, and amoebapores are associated with the invasion process. The parasite can cause extraintestinal infection like amoebic liver abscess by evading immune response. |
| hsa05163 | Human cytomegalovirus infection | Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells. |
| hsa05165 | Human papillomavirus infection | Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation. |
| hsa05170 | Human immunodeficiency virus 1 infection | Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time. |
| hsa05200 | Pathways in cancer | |
| hsa05202 | Transcriptional misregulation in cancer | In tumor cells, genes encoding transcription factors (TFs) are often amplified, deleted, rearranged via chromosomal translocation and inversion, or subjected to point mutations that result in a gain- or loss-of- function. In hematopoietic cancers and solid tumors, the translocations and inversions increase or deregulate transcription of the oncogene. Recurrent chromosome translocations generate novel fusion oncoproteins, which are common in myeloid cancers and soft-tissue sarcomas. The fusion proteins have aberrant transcriptional function compared to their wild-type counterparts. These fusion transcription factors alter expression of target genes, and thereby result in a variety of altered cellular properties that contribute to the tumourigenic process. |
| hsa05205 | Proteoglycans in cancer | Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors. |
| hsa05222 | Small cell lung cancer | Lung cancer is a leading cause of cancer death among men and women in industrialized countries. Small cell lung carcinoma (SCLC) is a highly aggressive neoplasm, which accounts for approximately 25% of all lung cancer cases. Molecular mechanisms altered in SCLC include induced expression of oncogene, MYC, and loss of tumorsuppressor genes, such as p53, PTEN, RB, and FHIT. The overexpression of MYC proteins in SCLC is largely a result of gene amplification. Such overexpression leads to more rapid proliferation and loss of terminal differentiation. Mutation or deletion of p53 or PTEN can lead to more rapid proliferation and reduced apoptosis. The retinoblastoma gene RB1 encodes a nuclear phosphoprotein that helps to regulate cell-cycle progression. The fragile histidine triad gene FHIT encodes the enzyme diadenosine triphosphate hydrolase, which is thought to have an indirect role in proapoptosis and cell-cycle control. |
| hsa05418 | Fluid shear stress and atherosclerosis | Shear stress represents the frictional force that the flow of blood exerts at the endothelial surface of the vessel wall and plays a central role in vascular biology and contributes to the progress of atherosclerosis. Sustained laminar flow with high shear stress upregulates expressions of endothelial cell (EC) genes and proteins that are protective against atherosclerosis. The key shear stress-induced transcription factors that govern the expression of these genes are Kruppel-like factor 2 (KLF2) and nuclear factor erythroid 2-like 2 (Nrf2). On the other hand, disturbed flow with associated reciprocating, low shear stress generally upregulates the EC genes and proteins that promote oxidative and inflammatory states in the artery wall, resulting in atherogenesis. Important transcriptional events that reflect this condition of ECs in disturbed flow include the activation of activator protein 1 (AP-1) and nuclear factor kappaB (NF-kappaB). |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-111465 | Apoptotic cleavage of cellular proteins. | Apoptotic cell death is achieved by the caspase-mediated\rcleavage of various vital proteins. Among caspase targets are proteins such as E-cadherin, Beta-catenin, alpha fodrin, GAS2, FADK, alpha adducin, HIP-55, and desmoglein involved in cell adhesion and maintenance of the cytoskeletal architecture. Cleavage of proteins such as APC and CIAP1 can further stimulate apoptosis by produce proapoptotic proteins (reviewed in Fischer et al., 2003. See also Wee et al., 2006 and the CASVM Caspase Substrates Database: http://www.casbase.org/casvm/squery/index.html ) |
| R-HSA-2029482 | Regulation of actin dynamics for phagocytic cup formation. | The actin cytoskeleton is fundamental for phagocytosis and members of the Rho family GTPases RAC and CDC42 are involved in actin cytoskeletal regulation leading to pseudopod extension. Active RAC and CDC42 exert their action through the members of WASP family proteins (WASP/N-WASP/WAVE) and ARP2/3 complex. Actin filaments move from the bottom toward the top of the phagocytic cup during pseudopod extension |
| R-HSA-354192 | Integrin alphaIIb beta3 signaling. | At the sites of vascular injury bioactive molecules such as thrombin, ADP, collagen, fibrinogen and thrombospondin are generated, secreted or exposed. These stimuli activate platelets, converting the major platelet integrin alphaIIbbeta3 from a resting state to an active conformation, in a process termed integrin priming or 'inside-out signalling'. Integrin activation refers to the change required to enhance ligand-binding activity. The activated alphaIIbbeta3 interacts with the fibrinogen and links platelets together in an aggregate to form a platelet plug. AlphaIIbbeta3 bound to fibrin generates more intracellular signals (outside-in signalling), causing further platelet activation and platelet-plug retraction. In the resting state the alpha and beta tails are close together. This interaction keeps the membrane proximal regions in a bent conformation that maintains alphaIIbbeta3 in a low affinity state. Integrin alphaIIbbeta3 is released from its inactive state by interaction with the protein talin. Talin interacts with the beta3 cytoplasmic domain and disrupts the salt bridge between the alpha and beta chains. This separation in the cytoplasmic regions triggers the conformational change in the extracellular domain that increases its affinity to fibrinogen. Much of talin exists in an inactive cytosolic pool, and the Rap1 interacting adaptor molecule (RIAM) is implicated in talin activation and translocation to beta3 integrin cytoplasmic domain |
| R-HSA-354194 | GRB2:SOS provides linkage to MAPK signaling for Integrins. | Integrin signaling is linked to the MAP kinase pathway by recruiting Grb2 to the FADK1/SRC activation complex |
| R-HSA-372708 | p130Cas linkage to MAPK signaling for integrins. | Integrin signaling is linked to the MAP kinase pathway by recruiting p130cas and Crk to the FAK/Src activation complex |
| R-HSA-375165 | NCAM signaling for neurite out-growth. | The neural cell adhesion molecule, NCAM, is a member of the immunoglobulin (Ig) superfamily and is involved in a variety of cellular processes of importance for the formation and maintenance of the nervous system. The role of NCAM in neural differentiation and synaptic plasticity is presumed to depend on the modulation of intracellular signal transduction cascades. NCAM based signaling complexes can initiate downstream intracellular signals by at least two mechanisms: (1) activation of FGFR and (2) formation of intracellular signaling complexes by direct interaction with cytoplasmic interaction partners such as Fyn and FAK. Tyrosine kinases Fyn and FAK interact with NCAM and undergo phosphorylation and this transiently activates the MAPK, ERK 1 and 2, cAMP response element binding protein (CREB) and transcription factors ELK and NFkB. CREB activates transcription of genes which are important for axonal growth, survival, and synaptic plasticity in neurons.NCAM1 mediated intracellular signal transduction is represented in the figure below. The Ig domains in NCAM1 are represented in orange ovals and Fn domains in green squares. The tyrosine residues susceptible to phosphorylation are represented in red circles and their positions are numbered. Phosphorylation is represented by red arrows and dephosphorylation by yellow. Ig, Immunoglobulin domain; Fn, Fibronectin domain; Fyn, Proto-oncogene tyrosine-protein kinase Fyn; FAK, focal adhesion kinase; RPTPalpha, Receptor-type tyrosine-protein phosphatase; Grb2, Growth factor receptor-bound protein 2; SOS, Son of sevenless homolog; Raf, RAF proto-oncogene serine/threonine-protein kinase; MEK, MAPK and ERK kinase; ERK, Extracellular signal-regulated kinase; MSK1, Mitogen and stress activated protein kinase 1; CREB, Cyclic AMP-responsive element-binding protein; CRE, cAMP response elements |
| R-HSA-391160 | Signal regulatory protein family interactions. | Signal regulatory protein alpha (SIRPA, SHPS1, CD172a) is a transmembrane protein expressed mostly on myeloid cells. CD47, a widely expressed transmembrane protein, is a ligand for SIRP alpha, with the two proteins constituting a cell-cell communication system. The interaction of SIRPA with CD47 is important for the regulation of migration and phagocytosis. SIRPA functions as a docking protein to recruit and activate PTPN6 (SHP-1) or PTPN11 (SHP-2) at the cell membrane in response to extracellular stimuli. SIRPA also binds other intracellular proteins including the adaptor molecules Src kinase-associated protein (SKAP2 SKAP55hom/R), Fyn-binding protein/SLP-76-associated phosphoprotein (FYB/SLAP-130) and the tyrosine kinase PYK2. SIRPA also binds the extracellular proteins, surfactant-A (SP-A) and surfactant-D (SP-D). The SIRP family members SIRPB and SIRPG show high sequence similarity and similar extracellular structural topology, including three Ig domains, but their ligand binding topology might differ. SIRPB is expressed on myeloid cells, including monocytes, granulocytes and DCs. It has no known natural ligand. SIRPG can bind CD47 but with lower affinity than SIRPA |
| R-HSA-3928662 | EPHB-mediated forward signaling. | Multiple EPHB receptors contribute directly to dendritic spine development and morphogenesis. These are more broadly involved in post-synaptic development through activation of focal adhesion kinase (FAK) and Rho family GTPases and their GEFs. Dendritic spine morphogenesis is a vital part of the process of synapse formation and maturation during CNS development. Dendritic spine morphogenesis is characterized by filopodia shortening followed by the formation of mature mushroom-shaped spines (Moeller et al. 2006). EPHBs control neuronal morphology and motility by modulation of the actin cytoskeleton. EPHBs control dendritic filopodia motility, enabling synapse formation. EPHBs exert these effects through interacting with the guanine exchange factors (GEFs) such as intersectin and kalirin. The intersectin-CDC42-WASP-actin and kalirin-RAC-PAK-actin pathways have been proposed to regulate the EPHB receptor mediated morphogenesis and maturation of dendritic spines in cultured hippocampal and cortical neurons (Irie & Yamaguchi 2002, Penzes et al. 2003). EPHBs are also involved in the regulation of dendritic spine morphology through FAK which activates the RHOA-ROCK-LIMK-1 pathway to suppress cofilin activity and inhibit cofilin-mediated dendritic spine remodeling (Shi et al. 2009) |
| R-HSA-418885 | DCC mediated attractive signaling. | The DCC family includes DCC and neogenin in vertebrates. DCC is required for netrin-induced axon attraction. DCC is a transmembrane protein lacking any identifiable catalytic activity. Protein tyrosine kinase 2/FAK and src family kinases bind constitutively to the cytoplasmic domain of DCC and their activation couples to downstream intracellular signaling complex that directs the organization of actin |
| R-HSA-4420097 | VEGFA-VEGFR2 Pathway. | Angiogenesis is the formation of new blood vessels from preexisting vasculature. One of the most important proangiogenic factors is vascular endothelial growth factor (VEGF). VEGF exerts its biologic effect through interaction with transmembrane tyrosine kinase receptors VEGFR, selectively expressed on vascular endothelial cells. VEGFA signaling through VEGFR2 is the major pathway that activates angiogenesis by inducing the proliferation, survival, sprouting and migration of endothelial cells (ECs), and also by increasing endothelial permeability (Lohela et al. 2009, Shibuya & Claesson-Welsh 2006, Claesson-Welsh & Welsh, 2013). The critical role of VEGFR2 in vascular development is highlighted by the fact that VEGFR2-/- mice die at E8.5-9.5 due to defective development of blood islands, endothelial cells and haematopoietic cells (Shalaby et al. 1995) |
| R-HSA-5663213 | RHO GTPases Activate WASPs and WAVEs. | WASP and WAVE proteins belong to the Wiskott-Aldrich Syndrome protein family, with recessive mutations in the founding member WASP being responsible for the X-linked recessive immunodeficieny known as the Wiskott-Aldrich Syndrome. WASP proteins include WASP and WASL (N-WASP). WAVE proteins include WASF1 (WAVE1), WASF2 (WAVE2) and WASF3 (WAVE3). WASPs and WAVEs contain a VCA domain (consisting of WH2 and CA subdomains) at the C-terminus, responsible for binding to G-actin (WH2 subdomain) and the actin-associated ARP2/3 complex (CA subdomain). WASPs contain a WH1 (WASP homology 1) domain at the N-terminus, responsible for binding to WIPs (WASP-interacting proteins). A RHO GTPase binding domain (GBD) is located in the N-terminal half of WASPs and C-terminally located in WAVEs. RHO GTPases activate WASPs by disrupting the autoinhibitory interaction between the GBD and VCA domains, which allows WASPs to bind actin and the ARP2/3 complex and act as nucleation promoting factors in actin polymerization. WAVEs have the WAVE/SCAR homology domain (WHD/SHD) at the N-terminus, which binds ABI, NCKAP1, CYFIP2 and BRK1 to form the WAVE regulatory complex (WRC). Binding of the RAC1:GTP to the GBD of WAVEs most likely induces a conformational change in the WRC that allows activating phosphorylation of WAVEs by ABL1, thus enabling them to function as nucleation promoting factors in actin polymerization through binding G-actin and the ARP2/3 complex (Reviewed by Lane et al. 2014) |
| R-HSA-5673001 | RAF/MAP kinase cascade. | The RAS-RAF-MEK-ERK pathway regulates processes such as proliferation, differentiation, survival, senescence and cell motility in response to growth factors, hormones and cytokines, among others. Binding of these stimuli to receptors in the plasma membrane promotes the GEF-mediated activation of RAS at the plasma membrane and initiates the three-tiered kinase cascade of the conventional MAPK cascades. GTP-bound RAS recruits RAF (the MAPK kinase kinase), and promotes its dimerization and activation (reviewed in Cseh et al, 2014; Roskoski, 2010; McKay and Morrison, 2007; Wellbrock et al, 2004). Activated RAF phosphorylates the MAPK kinase proteins MEK1 and MEK2 (also known as MAP2K1 and MAP2K2), which in turn phophorylate the proline-directed kinases ERK1 and 2 (also known as MAPK3 and MAPK1) (reviewed in Roskoski, 2012a, b; Kryiakis and Avruch, 2012). Activated ERK proteins may undergo dimerization and have identified targets in both the nucleus and the cytosol; consistent with this, a proportion of activated ERK protein relocalizes to the nucleus in response to stimuli (reviewed in Roskoski 2012b; Turjanski et al, 2007; Plotnikov et al, 2010; Cargnello et al, 2011). Although initially seen as a linear cascade originating at the plasma membrane and culminating in the nucleus, the RAS/RAF MAPK cascade is now also known to be activated from various intracellular location. Temporal and spatial specificity of the cascade is achieved in part through the interaction of pathway components with numerous scaffolding proteins (reviewed in McKay and Morrison, 2007; Brown and Sacks, 2009). The importance of the RAS/RAF MAPK cascade is highlighted by the fact that components of this pathway are mutated with high frequency in a large number of human cancers. Activating mutations in RAS are found in approximately one third of human cancers, while ~8% of tumors express an activated form of BRAF (Roberts and Der, 2007; Davies et al, 2002; Cantwell-Dorris et al, 2011) |
| R-HSA-8874081 | MET activates PTK2 signaling. | MET receptor activates the focal adhesion kinase PTK2 (FAK1) in a process that depends on the simultaneous interaction of PTK2 with integrins and with MET. SRC is needed for PTK2 to become fully active. Activation of PTK2 is needed for HGF-induced cell motility (Beviglia et al. 1999, Parr et al. 2001, Chen and Chen 2006, Lietha et al. 2007, Chen et al. 2011, Brami-Cherrier et al. 2014) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AMPH | Affinity Capture-Western | physical | 12558988, (Europe PMC) | NA | BioGRID |
| APC | Co-localization | physical | 25241761, (Europe PMC) | NA | BioGRID |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| ARHGAP26 | Reconstituted Complex | physical | 8649427, (Europe PMC) | NA | BioGRID |
| ASAP1 | Affinity Capture-Western | physical | 17893324, (Europe PMC) | NA | BioGRID |
| ATG12 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| BBS10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BCAR1 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| BIN1 | Affinity Capture-Western | physical | 12558988, (Europe PMC) | NA | BioGRID |
| BMX | Affinity Capture-Western, Reconstituted Complex | physical | 11331870, (Europe PMC) | NA | BioGRID |
| CBL | Affinity Capture-Western, Co-localization | physical | 12771190, 17675501, 22203672, (Europe PMC) | NA | BioGRID |
| CCNA1 | Co-localization, anti bait coimmunoprecipitation, proximity ligation assay | physical, physical association | 17353931, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| CCR5 | Affinity Capture-Western | physical | 10384144, (Europe PMC) | NA | BioGRID |
| CDH5 | Affinity Capture-Western | physical | 22720799, (Europe PMC) | NA | BioGRID |
| CIB1 | Affinity Capture-Western | physical | 12881299, (Europe PMC) | NA | BioGRID |
| CRK | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid | physical, physical association | 10085298, 12615911, 25814554, 7561682, (Europe PMC) | 0.63 | BioGRID, IntAct |
| CSK | Affinity Capture-Western | physical | 7529872, (Europe PMC) | NA | BioGRID |
| CTTN | Affinity Capture-Western | physical | 17893324, (Europe PMC) | NA | BioGRID |
| CXCR4 | Affinity Capture-Western | physical | 11668182, (Europe PMC) | NA | BioGRID |
| DAG1 | Affinity Capture-Western | physical | 18341635, (Europe PMC) | NA | BioGRID |
| DCC | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation | association, physical | 15494733, 20434207, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX39A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DEF6 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| DOCK1 | Affinity Capture-Western | physical | 12615911, (Europe PMC) | NA | BioGRID |
| DOK4 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| EEF1G | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-Western, PCA, Two-hybrid, anti bait coimmunoprecipitation, ubiquitin reconstruction | association, physical, physical association | 10806474, 15657067, 24658140, 25402006, (Europe PMC) | 0.55 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| EPHA2 | Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy | physical, physical association | 10655584, (Europe PMC) | 0.49 | BioGRID, IntAct |
| EPS8L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ERBB2 | Affinity Capture-Western, Co-localization, coimmunoprecipitation, proximity ligation assay | physical, physical association | 12600989, 21034468, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| EZR | Reconstituted Complex | physical | 11468295, (Europe PMC) | NA | BioGRID |
| F13A1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FGR | Affinity Capture-Western | physical | 12387730, (Europe PMC) | NA | BioGRID |
| FYN | Affinity Capture-Western, Co-crystal Structure | physical | 11278857, 12558988, (Europe PMC) | NA | BioGRID |
| GAPDH | Co-fractionation | physical | 18206965, (Europe PMC) | NA | BioGRID |
| GIT1 | Affinity Capture-Western, Reconstituted Complex | physical | 10938112, 12473661, 12629171, (Europe PMC) | NA | BioGRID |
| GNB1 | Affinity Capture-Western | physical | 19917775, (Europe PMC) | NA | BioGRID |
| GNG2 | Affinity Capture-Western | physical | 19917775, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid | association, physical, physical association | 10085298, 10806474, 12005431, 12558988, 21900206, 7597091, 8649427, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| GRB7 | Affinity Capture-Luminescence, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 10446223, 11119718, 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| GSK3B | Affinity Capture-Western | physical | 11809746, (Europe PMC) | NA | BioGRID |
| GSN | Affinity Capture-Western | physical | 11577104, (Europe PMC) | NA | BioGRID |
| HCK | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-Luminescence | physical | 22939624, (Europe PMC) | NA | BioGRID |
| IGF1R | Affinity Capture-Western | physical | 10082579, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-Western | physical | 24639526, (Europe PMC) | NA | BioGRID |
| IRS1 | Affinity Capture-Western, Two-hybrid | physical | 9822703, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-Western | physical | 11919182, (Europe PMC) | NA | BioGRID |
| ITGAV | Affinity Capture-Western | physical | 12844492, 19889638, (Europe PMC) | NA | BioGRID |
| ITGB1 | Affinity Capture-Western, Co-localization | physical | 19889638, 25792870, 26992741, (Europe PMC) | NA | BioGRID |
| ITGB3 | Affinity Capture-Western, Reconstituted Complex | physical | 11927607, 19889638, 9169439, (Europe PMC) | NA | BioGRID |
| ITGB5 | Affinity Capture-Western, Reconstituted Complex | physical | 11927607, 15673687, (Europe PMC) | NA | BioGRID |
| JAK2 | Affinity Capture-Western | physical | 10925297, 9553131, (Europe PMC) | NA | BioGRID |
| LPXN | Affinity Capture-MS, Two-hybrid, two hybrid | physical, physical association | 21900206, 28514442, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| LYN | Affinity Capture-Western, Two-hybrid, coimmunoprecipitation, two hybrid array | physical, physical association | 11389892, 25814554, 9169439, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| MAPK8IP3 | Affinity Capture-Western | physical | 12226752, (Europe PMC) | NA | BioGRID |
| MDM2 | Reconstituted Complex | physical | 18206965, (Europe PMC) | NA | BioGRID |
| NACAD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NASP | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NCK1 | Affinity Capture-Western, Reconstituted Complex | physical | 11950595, 8879209, (Europe PMC) | NA | BioGRID |
| NCK2 | Affinity Capture-Western, Reconstituted Complex | physical | 11950595, (Europe PMC) | NA | BioGRID |
| NEDD9 | Affinity Capture-Western, Two-hybrid | physical | 8668148, (Europe PMC) | NA | BioGRID |
| NEO1 | Affinity Capture-Western, Two-hybrid | physical | 15494733, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OTUD6B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PARP1 | Co-fractionation | physical | 18206965, (Europe PMC) | NA | BioGRID |
| PDCD6IP | Affinity Capture-Western | physical | 12771190, (Europe PMC) | NA | BioGRID |
| PIAS1 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PIK3R1 | Affinity Capture-Western, Far Western | physical | 10973983, 11119718, 19889638, 7537275, (Europe PMC) | NA | BioGRID |
| PIK3R3 | Affinity Capture-Luminescence, Two-hybrid, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid array | association, physical, physical association | 22402981, 25814554, (Europe PMC) | 0.63 | BioGRID, IntAct |
| PKD1 | Affinity Capture-Western | physical | 11113628, (Europe PMC) | NA | BioGRID |
| PLCG1 | Affinity Capture-Western, proximity ligation assay | physical, physical association | 10430888, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PPP1CA | Affinity Capture-Western | physical | 17274640, (Europe PMC) | NA | BioGRID |
| PPP1CB | Affinity Capture-Western | physical | 11513739, 17274640, (Europe PMC) | NA | BioGRID |
| PRKG1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PTAFR | Affinity Capture-Western | physical | 20576130, (Europe PMC) | NA | BioGRID |
| PTEN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay | physical, physical association | 10400703, 11857088, 15717329, 23397142, 9927060, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PTK2 | Co-crystal Structure, x-ray crystallography | direct interaction, physical | 12005431, 24480479, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PTPN11 | Affinity Capture-Western | physical | 10082579, 21726809, (Europe PMC) | NA | BioGRID |
| PTPN6 | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| PTRH2 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 21383007, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PXN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, far western blotting, fluorescence microscopy, pull down | colocalization, physical, physical association | 10330411, 10455189, 10753828, 10980697, 11514617, 11919182, 21034468, 21741599, 22270917, 7561682, 8922390, 9054445, 9422762, 9442086, 9756887, (Europe PMC) | 0.88 | BioGRID, IntAct |
| RAC1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 20936779, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RB1CC1 | Affinity Capture-Western, Reconstituted Complex | physical | 10769033, (Europe PMC) | NA | BioGRID |
| RBSN | Affinity Capture-Western | physical | 19931244, (Europe PMC) | NA | BioGRID |
| RET | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SAE1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SELE | Reconstituted Complex | physical | 8609175, (Europe PMC) | NA | BioGRID |
| SERPINB2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SH2D1A | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SH2D1B | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH2D2A | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| SH3KBP1 | Affinity Capture-Western | physical | 12771190, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-Western | physical | 11980671, (Europe PMC) | NA | BioGRID |
| SOCS2 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| SOCS3 | Affinity Capture-Western, Two-hybrid | physical | 16007195, 18031698, 25416956, (Europe PMC) | NA | BioGRID |
| SRC | Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity ligation assay, two hybrid array | association, physical, physical association | 10085298, 11119718, 11980671, 12387730, 12558988, 12615911, 16291744, 16966330, 17525734, 21034468, 21855630, 22402981, 23065768, 23242524, 25241761, 25814554, 9822703, (Europe PMC) | 0.92 | BioGRID, IntAct, MINT |
| SRPK1 | Biochemical Activity | physical | 23602568, (Europe PMC) | NA | BioGRID |
| STAP2 | Affinity Capture-Western | physical | 17675501, (Europe PMC) | NA | BioGRID |
| STAT1 | Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay | physical, physical association | 11278462, 20576130, 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STAT3 | Affinity Capture-Western, Co-localization | physical | 10925297, 25241761, (Europe PMC) | NA | BioGRID |
| STUB1 | Affinity Capture-Western | physical | 22734001, (Europe PMC) | NA | BioGRID |
| SYK | Affinity Capture-Western | physical | 9169439, 9342235, (Europe PMC) | NA | BioGRID |
| TEK | Co-localization | physical | 25792870, (Europe PMC) | NA | BioGRID |
| TGFB1I1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid | physical, physical association | 11463817, 21900206, 9422762, 9756887, 9858471, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| TLN1 | Affinity Capture-Western, Reconstituted Complex | physical | 7622520, 9442086, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, pull down | colocalization, direct interaction, physical, physical association | 15855171, 18206965, 19857493, 25241761, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| TRIM15 | PCA | physical | 25450970, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIM72 | Affinity Capture-Western | physical | 24344130, (Europe PMC) | NA | BioGRID |
| TRIP6 | Affinity Capture-Western | physical | 14688263, (Europe PMC) | NA | BioGRID |
| TRMT6 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TSC1 | Affinity Capture-Western | physical | 17043358, (Europe PMC) | NA | BioGRID |
| TSC2 | Affinity Capture-Western, Reconstituted Complex | physical | 17043358, (Europe PMC) | NA | BioGRID |
| UBE2H | Affinity Capture-Western | physical | 24344130, (Europe PMC) | NA | BioGRID |
| VPS16 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YES1 | Affinity Capture-Western, Two-hybrid, proximity ligation assay | physical, physical association | 12558988, 23397142, 25416956, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ZNF331 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| APC | proximity ligation assay | physical association | 25241761, (Europe PMC) | 0.40 | IntAct |
| BBS10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BCAR1 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| CCNA1 | Co-localization, anti bait coimmunoprecipitation, proximity ligation assay | physical, physical association | 17353931, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| CD36 | pull down | association | 20037584, (Europe PMC) | 0.35 | IntAct |
| CRK | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid | physical, physical association | 10085298, 12615911, 25814554, 7561682, (Europe PMC) | 0.63 | BioGRID, IntAct |
| CRKL | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| DCC | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation | association, physical | 15494733, 20434207, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX39A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DOK4 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DVL1 | anti bait coimmunoprecipitation | association | 20224554, (Europe PMC) | 0.35 | IntAct, MINT |
| DVL1P1 | anti bait coimmunoprecipitation | association | 20224554, (Europe PMC) | 0.35 | IntAct, MINT |
| EEF1G | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-Western, PCA, Two-hybrid, anti bait coimmunoprecipitation, ubiquitin reconstruction | association, physical, physical association | 10806474, 15657067, 24658140, 25402006, (Europe PMC) | 0.55 | BioGRID, IntAct |
| EPHA2 | Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy | physical, physical association | 10655584, (Europe PMC) | 0.49 | BioGRID, IntAct |
| EPS8L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ERBB2 | Affinity Capture-Western, Co-localization, coimmunoprecipitation, proximity ligation assay | physical, physical association | 12600989, 21034468, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| F13A1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FLT1 | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| GRB2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid | association, physical, physical association | 10085298, 10806474, 12005431, 12558988, 21900206, 7597091, 8649427, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| GRB7 | Affinity Capture-Luminescence, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 10446223, 11119718, 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| HCK | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HSP90AB1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| ITGAV | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| ITGB4 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical association | 27178753, (Europe PMC) | 0.52 | IntAct, MINT |
| LPXN | Affinity Capture-MS, Two-hybrid, two hybrid | physical, physical association | 21900206, 28514442, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| LYN | Affinity Capture-Western, Two-hybrid, coimmunoprecipitation, two hybrid array | physical, physical association | 11389892, 25814554, 9169439, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| MAL | anti bait coimmunoprecipitation | association | 22366891, (Europe PMC) | 0.35 | IntAct |
| NACAD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NASP | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIAS1 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PIK3CA | anti bait coimmunoprecipitation | association | 22402981, (Europe PMC) | 0.35 | IntAct |
| PIK3R2 | anti bait coimmunoprecipitation | association | 22402981, (Europe PMC) | 0.35 | IntAct |
| PIK3R3 | Affinity Capture-Luminescence, Two-hybrid, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid array | association, physical, physical association | 22402981, 25814554, (Europe PMC) | 0.63 | BioGRID, IntAct |
| PKM | protein kinase assay | phosphorylation reaction | 24606918, (Europe PMC) | 0.44 | IntAct |
| PLCG1 | Affinity Capture-Western, proximity ligation assay | physical, physical association | 10430888, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PTEN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay | physical, physical association | 10400703, 11857088, 15717329, 23397142, 9927060, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PTK2 | Co-crystal Structure, x-ray crystallography | direct interaction, physical | 12005431, 24480479, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PTPN23 | anti bait coimmunoprecipitation, fluorescence technology, protein kinase assay, pull down | colocalization, direct interaction, phosphorylation reaction, physical association | 18835089, (Europe PMC) | 0.64 | IntAct, MINT |
| PTPN6 | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| PTRH2 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 21383007, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PXN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, far western blotting, fluorescence microscopy, pull down | colocalization, physical, physical association | 10330411, 10455189, 10753828, 10980697, 11514617, 11919182, 21034468, 21741599, 22270917, 7561682, 8922390, 9054445, 9422762, 9442086, 9756887, (Europe PMC) | 0.88 | BioGRID, IntAct |
| RAC1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 20936779, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RET | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RHOU | anti tag coimmunoprecipitation | physical association | 18086875, (Europe PMC) | 0.40 | IntAct |
| SAE1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH2D1A | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SH2D1B | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH2D2A | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| SRC | Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity ligation assay, two hybrid array | association, physical, physical association | 10085298, 11119718, 11980671, 12387730, 12558988, 12615911, 16291744, 16966330, 17525734, 21034468, 21855630, 22402981, 23065768, 23242524, 25241761, 25814554, 9822703, (Europe PMC) | 0.92 | BioGRID, IntAct, MINT |
| SRPK1 | protein kinase assay | phosphorylation reaction | 23602568, (Europe PMC) | 0.44 | IntAct |
| STAT1 | Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay | physical, physical association | 11278462, 20576130, 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STAT3 | proximity ligation assay | physical association | 25241761, (Europe PMC) | 0.40 | IntAct |
| TGFB1I1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid | physical, physical association | 11463817, 21900206, 9422762, 9756887, 9858471, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| TNS3 | far western blotting, fluorescence microscopy, pull down | colocalization, physical association | 19732724, (Europe PMC) | 0.56 | IntAct |
| TP53 | Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, pull down | colocalization, direct interaction, physical, physical association | 15855171, 18206965, 19857493, 25241761, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| VPS16 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YES1 | Affinity Capture-Western, Two-hybrid, proximity ligation assay | physical, physical association | 12558988, 23397142, 25416956, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ZNF331 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| BCAR1 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| DDX39A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DVL1 | anti bait coimmunoprecipitation | association | 20224554, (Europe PMC) | 0.35 | IntAct, MINT |
| DVL1P1 | anti bait coimmunoprecipitation | association | 20224554, (Europe PMC) | 0.35 | IntAct, MINT |
| EEF1G | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EPS8L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| F13A1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GRB2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid | association, physical, physical association | 10085298, 10806474, 12005431, 12558988, 21900206, 7597091, 8649427, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ITGB4 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical association | 27178753, (Europe PMC) | 0.52 | IntAct, MINT |
| LPXN | Affinity Capture-MS, Two-hybrid, two hybrid | physical, physical association | 21900206, 28514442, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| LYN | Affinity Capture-Western, Two-hybrid, coimmunoprecipitation, two hybrid array | physical, physical association | 11389892, 25814554, 9169439, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| NACAD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NASP | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PTK2 | Co-crystal Structure, x-ray crystallography | direct interaction, physical | 12005431, 24480479, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PTPN23 | anti bait coimmunoprecipitation, fluorescence technology, protein kinase assay, pull down | colocalization, direct interaction, phosphorylation reaction, physical association | 18835089, (Europe PMC) | 0.64 | IntAct, MINT |
| SRC | Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity ligation assay, two hybrid array | association, physical, physical association | 10085298, 11119718, 11980671, 12387730, 12558988, 12615911, 16291744, 16966330, 17525734, 21034468, 21855630, 22402981, 23065768, 23242524, 25241761, 25814554, 9822703, (Europe PMC) | 0.92 | BioGRID, IntAct, MINT |
| TGFB1I1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid | physical, physical association | 11463817, 21900206, 9422762, 9756887, 9858471, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| TP53 | Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, pull down | colocalization, direct interaction, physical, physical association | 15855171, 18206965, 19857493, 25241761, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| ZNF331 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AMPH | Affinity Capture-Western | physical | 12558988, (Europe PMC) | NA | BioGRID |
| ANGPTL4 | anti bait coimmunoprecipitation | association | 21397862, (Europe PMC) | 0.35 | IntAct |
| APC | Co-localization | physical | 25241761, (Europe PMC) | NA | BioGRID |
| APC | proximity ligation assay | physical association | 25241761, (Europe PMC) | 0.40 | IntAct |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| ARHGAP26 | Reconstituted Complex | physical | 8649427, (Europe PMC) | NA | BioGRID |
| ASAP1 | Affinity Capture-Western | physical | 17893324, (Europe PMC) | NA | BioGRID |
| ATG12 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| BBS10 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BCAR1 | Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding | physical, physical association | 10753828, 11577104, 11839772, 12135674, 12615911, 15673687, 21034468, 21855630, 8649427, 8810278, 9285683, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| BIN1 | Affinity Capture-Western | physical | 12558988, (Europe PMC) | NA | BioGRID |
| BMX | Affinity Capture-Western, Reconstituted Complex | physical | 11331870, (Europe PMC) | NA | BioGRID |
| CBL | Affinity Capture-Western, Co-localization | physical | 12771190, 17675501, 22203672, (Europe PMC) | NA | BioGRID |
| CCNA1 | Co-localization, anti bait coimmunoprecipitation, proximity ligation assay | physical, physical association | 17353931, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| CCR5 | Affinity Capture-Western | physical | 10384144, (Europe PMC) | NA | BioGRID |
| CD36 | pull down | association | 20037584, (Europe PMC) | 0.35 | IntAct |
| CDH5 | Affinity Capture-Western | physical | 22720799, (Europe PMC) | NA | BioGRID |
| CIB1 | Affinity Capture-Western | physical | 12881299, (Europe PMC) | NA | BioGRID |
| CRK | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid | physical, physical association | 10085298, 12615911, 25814554, 7561682, (Europe PMC) | 0.63 | BioGRID, IntAct |
| CRKL | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| CSK | Affinity Capture-Western | physical | 7529872, (Europe PMC) | NA | BioGRID |
| CTTN | Affinity Capture-Western | physical | 17893324, (Europe PMC) | NA | BioGRID |
| CXCR4 | Affinity Capture-Western | physical | 11668182, (Europe PMC) | NA | BioGRID |
| DAG1 | Affinity Capture-Western | physical | 18341635, (Europe PMC) | NA | BioGRID |
| DCC | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation | association, physical | 15494733, 20434207, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX39A | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DEF6 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| DOCK1 | Affinity Capture-Western | physical | 12615911, (Europe PMC) | NA | BioGRID |
| DOK4 | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| DVL1 | anti bait coimmunoprecipitation | association | 20224554, (Europe PMC) | 0.35 | IntAct, MINT |
| DVL1P1 | anti bait coimmunoprecipitation | association | 20224554, (Europe PMC) | 0.35 | IntAct, MINT |
| EEF1G | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| EGFR | Affinity Capture-Western, PCA, Two-hybrid, anti bait coimmunoprecipitation, ubiquitin reconstruction | association, physical, physical association | 10806474, 15657067, 24658140, 25402006, (Europe PMC) | 0.55 | BioGRID, IntAct |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| EPHA2 | Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy | physical, physical association | 10655584, (Europe PMC) | 0.49 | BioGRID, IntAct |
| EPS8L2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ERBB2 | Affinity Capture-Western, Co-localization, coimmunoprecipitation, proximity ligation assay | physical, physical association | 12600989, 21034468, 25241761, (Europe PMC) | 0.59 | BioGRID, IntAct |
| EZR | Reconstituted Complex | physical | 11468295, (Europe PMC) | NA | BioGRID |
| F13A1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FBP1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FGR | Affinity Capture-Western | physical | 12387730, (Europe PMC) | NA | BioGRID |
| FLT1 | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| FYN | Affinity Capture-Western, Co-crystal Structure | physical | 11278857, 12558988, (Europe PMC) | NA | BioGRID |
| GAPDH | Co-fractionation | physical | 18206965, (Europe PMC) | NA | BioGRID |
| GIT1 | Affinity Capture-Western, Reconstituted Complex | physical | 10938112, 12473661, 12629171, (Europe PMC) | NA | BioGRID |
| GNB1 | Affinity Capture-Western | physical | 19917775, (Europe PMC) | NA | BioGRID |
| GNG2 | Affinity Capture-Western | physical | 19917775, (Europe PMC) | NA | BioGRID |
| GRB2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid | association, physical, physical association | 10085298, 10806474, 12005431, 12558988, 21900206, 7597091, 8649427, (Europe PMC) | 0.55 | BioGRID, IntAct, MINT |
| GRB7 | Affinity Capture-Luminescence, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 10446223, 11119718, 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| GSK3B | Affinity Capture-Western | physical | 11809746, (Europe PMC) | NA | BioGRID |
| GSN | Affinity Capture-Western | physical | 11577104, (Europe PMC) | NA | BioGRID |
| HCK | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.51 | BioGRID, IntAct |
| HES1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-Luminescence | physical | 22939624, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | luminescence based mammalian interactome mapping | physical association | 22939624, (Europe PMC) | 0.40 | IntAct |
| IGF1R | Affinity Capture-Western | physical | 10082579, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-Western | physical | 24639526, (Europe PMC) | NA | BioGRID |
| IRS1 | Affinity Capture-Western, Two-hybrid | physical | 9822703, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-Western | physical | 11919182, (Europe PMC) | NA | BioGRID |
| ITGAV | Affinity Capture-Western | physical | 12844492, 19889638, (Europe PMC) | NA | BioGRID |
| ITGAV | proximity ligation assay | physical association | 23397142, (Europe PMC) | 0.40 | IntAct |
| ITGB1 | Affinity Capture-Western, Co-localization | physical | 19889638, 25792870, 26992741, (Europe PMC) | NA | BioGRID |
| ITGB3 | Affinity Capture-Western, Reconstituted Complex | physical | 11927607, 19889638, 9169439, (Europe PMC) | NA | BioGRID |
| ITGB4 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical association | 27178753, (Europe PMC) | 0.52 | IntAct, MINT |
| ITGB5 | Affinity Capture-Western, Reconstituted Complex | physical | 11927607, 15673687, (Europe PMC) | NA | BioGRID |
| JAK2 | Affinity Capture-Western | physical | 10925297, 9553131, (Europe PMC) | NA | BioGRID |
| LPXN | Affinity Capture-MS, Two-hybrid, two hybrid | physical, physical association | 21900206, 28514442, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| LYN | Affinity Capture-Western, Two-hybrid, coimmunoprecipitation, two hybrid array | physical, physical association | 11389892, 25814554, 9169439, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| MAL | anti bait coimmunoprecipitation | association | 22366891, (Europe PMC) | 0.35 | IntAct |
| MAPK8IP3 | Affinity Capture-Western | physical | 12226752, (Europe PMC) | NA | BioGRID |
| MDM2 | Reconstituted Complex | physical | 18206965, (Europe PMC) | NA | BioGRID |
| NACAD | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NASP | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NCK1 | Affinity Capture-Western, Reconstituted Complex | physical | 11950595, 8879209, (Europe PMC) | NA | BioGRID |
| NCK2 | Affinity Capture-Western, Reconstituted Complex | physical | 11950595, (Europe PMC) | NA | BioGRID |
| NEDD9 | Affinity Capture-Western, Two-hybrid | physical | 8668148, (Europe PMC) | NA | BioGRID |
| NEO1 | Affinity Capture-Western, Two-hybrid | physical | 15494733, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OTUD6B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PARP1 | Co-fractionation | physical | 18206965, (Europe PMC) | NA | BioGRID |
| PDCD6IP | Affinity Capture-Western | physical | 12771190, (Europe PMC) | NA | BioGRID |
| PIAS1 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PIK3CA | anti bait coimmunoprecipitation | association | 22402981, (Europe PMC) | 0.35 | IntAct |
| PIK3R1 | Affinity Capture-Western, Far Western | physical | 10973983, 11119718, 19889638, 7537275, (Europe PMC) | NA | BioGRID |
| PIK3R2 | anti bait coimmunoprecipitation | association | 22402981, (Europe PMC) | 0.35 | IntAct |
| PIK3R3 | Affinity Capture-Luminescence, Two-hybrid, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid array | association, physical, physical association | 22402981, 25814554, (Europe PMC) | 0.63 | BioGRID, IntAct |
| PKD1 | Affinity Capture-Western | physical | 11113628, (Europe PMC) | NA | BioGRID |
| PKM | protein kinase assay | phosphorylation reaction | 24606918, (Europe PMC) | 0.44 | IntAct |
| PLCG1 | Affinity Capture-Western, proximity ligation assay | physical, physical association | 10430888, 23397142, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PPP1CA | Affinity Capture-Western | physical | 17274640, (Europe PMC) | NA | BioGRID |
| PPP1CB | Affinity Capture-Western | physical | 11513739, 17274640, (Europe PMC) | NA | BioGRID |
| PRKG1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| PTAFR | Affinity Capture-Western | physical | 20576130, (Europe PMC) | NA | BioGRID |
| PTEN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay | physical, physical association | 10400703, 11857088, 15717329, 23397142, 9927060, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PTK2 | Co-crystal Structure, x-ray crystallography | direct interaction, physical | 12005431, 24480479, (Europe PMC) | 0.44 | BioGRID, IntAct, MINT |
| PTPN11 | Affinity Capture-Western | physical | 10082579, 21726809, (Europe PMC) | NA | BioGRID |
| PTPN23 | anti bait coimmunoprecipitation, fluorescence technology, protein kinase assay, pull down | colocalization, direct interaction, phosphorylation reaction, physical association | 18835089, (Europe PMC) | 0.64 | IntAct, MINT |
| PTPN6 | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| PTRH2 | Affinity Capture-Western, anti bait coimmunoprecipitation | physical, physical association | 21383007, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PXN | Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, far western blotting, fluorescence microscopy, pull down | colocalization, physical, physical association | 10330411, 10455189, 10753828, 10980697, 11514617, 11919182, 21034468, 21741599, 22270917, 7561682, 8922390, 9054445, 9422762, 9442086, 9756887, (Europe PMC) | 0.88 | BioGRID, IntAct |
| RAC1 | Two-hybrid, two hybrid pooling approach | physical, physical association | 20936779, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RB1CC1 | Affinity Capture-Western, Reconstituted Complex | physical | 10769033, (Europe PMC) | NA | BioGRID |
| RBSN | Affinity Capture-Western | physical | 19931244, (Europe PMC) | NA | BioGRID |
| RET | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| RHOU | anti tag coimmunoprecipitation | physical association | 18086875, (Europe PMC) | 0.40 | IntAct |
| SAE1 | Two-hybrid, two hybrid array | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SELE | Reconstituted Complex | physical | 8609175, (Europe PMC) | NA | BioGRID |
| SERPINB2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SH2D1A | Two-hybrid, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.49 | BioGRID, IntAct |
| SH2D1B | Two-hybrid, two hybrid array | physical, physical association | 25814554, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH2D2A | Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid | physical, physical association | 25814554, (Europe PMC) | 0.57 | BioGRID, IntAct |
| SH3KBP1 | Affinity Capture-Western | physical | 12771190, (Europe PMC) | NA | BioGRID |
| SHC1 | Affinity Capture-Western | physical | 11980671, (Europe PMC) | NA | BioGRID |
| SOCS2 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| SOCS3 | Affinity Capture-Western, Two-hybrid | physical | 16007195, 18031698, 25416956, (Europe PMC) | NA | BioGRID |
| SRC | Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, proximity ligation assay, two hybrid array | association, physical, physical association | 10085298, 11119718, 11980671, 12387730, 12558988, 12615911, 16291744, 16966330, 17525734, 21034468, 21855630, 22402981, 23065768, 23242524, 25241761, 25814554, 9822703, (Europe PMC) | 0.92 | BioGRID, IntAct, MINT |
| SRPK1 | Biochemical Activity | physical | 23602568, (Europe PMC) | NA | BioGRID |
| SRPK1 | protein kinase assay | phosphorylation reaction | 23602568, (Europe PMC) | 0.44 | IntAct |
| STAP2 | Affinity Capture-Western | physical | 17675501, (Europe PMC) | NA | BioGRID |
| STAT1 | Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay | physical, physical association | 11278462, 20576130, 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STAT3 | Affinity Capture-Western, Co-localization | physical | 10925297, 25241761, (Europe PMC) | NA | BioGRID |
| STAT3 | proximity ligation assay | physical association | 25241761, (Europe PMC) | 0.40 | IntAct |
| STUB1 | Affinity Capture-Western | physical | 22734001, (Europe PMC) | NA | BioGRID |
| SYK | Affinity Capture-Western | physical | 9169439, 9342235, (Europe PMC) | NA | BioGRID |
| TEK | Co-localization | physical | 25792870, (Europe PMC) | NA | BioGRID |
| TGFB1I1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid | physical, physical association | 11463817, 21900206, 9422762, 9756887, 9858471, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| TLN1 | Affinity Capture-Western, Reconstituted Complex | physical | 7622520, 9442086, (Europe PMC) | NA | BioGRID |
| TNS3 | far western blotting, fluorescence microscopy, pull down | colocalization, physical association | 19732724, (Europe PMC) | 0.56 | IntAct |
| TP53 | Affinity Capture-Western, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, pull down | colocalization, direct interaction, physical, physical association | 15855171, 18206965, 19857493, 25241761, (Europe PMC) | 0.76 | BioGRID, IntAct, MINT |
| TRIM15 | PCA | physical | 25450970, (Europe PMC) | NA | BioGRID |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TRIM72 | Affinity Capture-Western | physical | 24344130, (Europe PMC) | NA | BioGRID |
| TRIP6 | Affinity Capture-Western | physical | 14688263, (Europe PMC) | NA | BioGRID |
| TRMT6 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TSC1 | Affinity Capture-Western | physical | 17043358, (Europe PMC) | NA | BioGRID |
| TSC2 | Affinity Capture-Western, Reconstituted Complex | physical | 17043358, (Europe PMC) | NA | BioGRID |
| UBE2H | Affinity Capture-Western | physical | 24344130, (Europe PMC) | NA | BioGRID |
| VPS16 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YES1 | Affinity Capture-Western, Two-hybrid, proximity ligation assay | physical, physical association | 12558988, 23397142, 25416956, (Europe PMC) | 0.40 | BioGRID, IntAct |
| ZNF331 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |