Top PDCD10
Localization (UniProt annotation) Cytoplasm Golgi apparatus membrane;Peripheral membrane protein; Cytoplasmic side Cell membrane;Peripheral membrane protein; Cytoplasmic side Note=Partially co-localizes with endogenous PXN at the leading edges of migratingcells Function (UniProt annotation) Promotes cell proliferation Modulates apoptoticpathways Increases mitogen-activated protein kinase activity andSTK26 activity (PubMed:27807006) Important for cell migration,and for normal structure and assembly of the Golgi complex(PubMed:27807006) Important for KDR/VEGFR2 signaling Increasesthe stability of KDR/VEGFR2 and prevents its breakdown Requiredfor normal cardiovascular development Required for normalangiogenesis, vasculogenesis and hematopoiesis during embryonicdevelopment (By similarity) Catalytic Activity (UniProt annotation) N/A Protein Sequence MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESL
LRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRAL
EHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATP6V1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP6V1C2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C4orf19 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 26186194 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct CHMP5 Two-hybrid, two hybrid physical, physical association 16730941 , (Europe PMC )0.37 BioGRID, IntAct CLNS1A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CNN2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CTPS1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CTTNBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct CTTNBP2NL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct DCPS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EHD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ERP44 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EZR Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FAM174A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FERMT2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FGFR1OP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 26496610 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct FKBP9 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct GTF2E2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HEXA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HEXB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HK1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HNRNPF Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID MCC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MOB4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct NOL3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NUDCD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PCNA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PFAS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PPME1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2R1A Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 18782753 , 28330616 , (Europe PMC )0.53 BioGRID, IntAct PPP2R1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct PROSER2 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct SGTA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SIKE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct SLMAP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 24366813 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct SNRNP27 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID STK24 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bio-layer interferometry, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, direct interaction, physical, physical association 16189514 , 17353931 , 17657516 , 18782753 , 21516116 , 22863883 , 23455922 , 23541896 , 25416956 , 26344197 , 28514442 , (Europe PMC )0.70, 0.92 BioGRID, IntAct, MINT STK25 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti tag coimmunoprecipitation, cosedimentation in solution, molecular sieving, protein kinase assay, pull down, surface plasmon resonance, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid, x-ray crystallography association, direct interaction, phosphorylation reaction, physical, physical association 16189514 , 17657516 , 18782753 , 21516116 , 23455922 , 23665169 , 25416956 , 26186194 , 26344197 , 28514442 , (Europe PMC )0.97 BioGRID, IntAct, MINT STK26 Affinity Capture-MS, Co-fractionation, Two-hybrid physical 18782753 , 23455922 , 25416956 , 26344197 , 28514442 , (Europe PMC )NA BioGRID STRIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct STRN Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18782753 , 24366813 , 26496610 , 28514442 , (Europe PMC )0.49, 0.71 BioGRID, IntAct STRN3 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 18782753 , 24366813 , 26496610 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct STRN4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct TATDN1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TRAF3IP3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct UBR7 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UNK Affinity Capture-RNA physical 25737280 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.53 BioGRID, IntAct VCL Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CCM2 anti tag coimmunoprecipitation, confocal microscopy, pull down association, colocalization, direct interaction, physical association 17657516 , 23266514 , 27027284 , (Europe PMC )0.35, 0.68 IntAct, MINT CHMP5 Two-hybrid, two hybrid physical, physical association 16730941 , (Europe PMC )0.37 BioGRID, IntAct CTTNBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct CTTNBP2NL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct FGFR1OP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 26496610 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct KRIT1 anti tag coimmunoprecipitation association 17657516 , (Europe PMC )0.35 IntAct KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct MCC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MOB4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct PDCD10 cosedimentation in solution direct interaction 23665169 , (Europe PMC )0.44 IntAct PPP2CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2R1A Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 18782753 , 28330616 , (Europe PMC )0.53 BioGRID, IntAct PPP2R1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct PROSER2 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct PTPN13 anti tag coimmunoprecipitation, phosphatase assay, pull down, two hybrid association, dephosphorylation reaction, physical association 17657516 , (Europe PMC )0.44, 0.55 IntAct SIKE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct SLMAP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 24366813 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct STK24 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bio-layer interferometry, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, direct interaction, physical, physical association 16189514 , 17353931 , 17657516 , 18782753 , 21516116 , 22863883 , 23455922 , 23541896 , 25416956 , 26344197 , 28514442 , (Europe PMC )0.70, 0.92 BioGRID, IntAct, MINT STK25 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti tag coimmunoprecipitation, cosedimentation in solution, molecular sieving, protein kinase assay, pull down, surface plasmon resonance, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid, x-ray crystallography association, direct interaction, phosphorylation reaction, physical, physical association 16189514 , 17657516 , 18782753 , 21516116 , 23455922 , 23665169 , 25416956 , 26186194 , 26344197 , 28514442 , (Europe PMC )0.97 BioGRID, IntAct, MINT STK26 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bio-layer interferometry, molecular sieving, pull down, surface plasmon resonance, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, x-ray crystallography association, direct interaction, physical association 18782753 , 23455922 , 23541896 , 23665169 , (Europe PMC )0.74, 0.77 IntAct STRIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct STRN Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18782753 , 24366813 , 26496610 , 28514442 , (Europe PMC )0.49, 0.71 BioGRID, IntAct STRN3 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 18782753 , 24366813 , 26496610 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct STRN4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct TRAF3IP3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.53 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source STK24 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bio-layer interferometry, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, direct interaction, physical, physical association 16189514 , 17353931 , 17657516 , 18782753 , 21516116 , 22863883 , 23455922 , 23541896 , 25416956 , 26344197 , 28514442 , (Europe PMC )0.70, 0.92 BioGRID, IntAct, MINT STK25 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti tag coimmunoprecipitation, cosedimentation in solution, molecular sieving, protein kinase assay, pull down, surface plasmon resonance, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid, x-ray crystallography association, direct interaction, phosphorylation reaction, physical, physical association 16189514 , 17657516 , 18782753 , 21516116 , 23455922 , 23665169 , 25416956 , 26186194 , 26344197 , 28514442 , (Europe PMC )0.97 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATP6V1A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATP6V1C2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C4orf19 Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 26186194 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct CCM2 anti tag coimmunoprecipitation, confocal microscopy, pull down association, colocalization, direct interaction, physical association 17657516 , 23266514 , 27027284 , (Europe PMC )0.35, 0.68 IntAct, MINT CHMP5 Two-hybrid, two hybrid physical, physical association 16730941 , (Europe PMC )0.37 BioGRID, IntAct CLNS1A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CNN2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CTPS1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CTTNBP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct CTTNBP2NL Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct DCPS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EHD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ERP44 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID EZR Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FAM174A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FERMT2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FGFR1OP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 26496610 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct FKBP9 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct GTF2E2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HEXA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HEXB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HK1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HNRNPF Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID KRIT1 anti tag coimmunoprecipitation association 17657516 , (Europe PMC )0.35 IntAct KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct MCC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MOB4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct NOL3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NUDCD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PCNA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PDCD10 cosedimentation in solution direct interaction 23665169 , (Europe PMC )0.44 IntAct PFAS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PPME1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2R1A Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 18782753 , 28330616 , (Europe PMC )0.53 BioGRID, IntAct PPP2R1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , (Europe PMC )0.35 BioGRID, IntAct PROSER2 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct PTPN13 anti tag coimmunoprecipitation, phosphatase assay, pull down, two hybrid association, dephosphorylation reaction, physical association 17657516 , (Europe PMC )0.44, 0.55 IntAct SGTA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SIKE1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct SLMAP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 24366813 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct SNRNP27 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID STK24 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bio-layer interferometry, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid association, direct interaction, physical, physical association 16189514 , 17353931 , 17657516 , 18782753 , 21516116 , 22863883 , 23455922 , 23541896 , 25416956 , 26344197 , 28514442 , (Europe PMC )0.70, 0.92 BioGRID, IntAct, MINT STK25 Affinity Capture-MS, Co-fractionation, Two-hybrid, anti tag coimmunoprecipitation, cosedimentation in solution, molecular sieving, protein kinase assay, pull down, surface plasmon resonance, tandem affinity purification, two hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid, x-ray crystallography association, direct interaction, phosphorylation reaction, physical, physical association 16189514 , 17657516 , 18782753 , 21516116 , 23455922 , 23665169 , 25416956 , 26186194 , 26344197 , 28514442 , (Europe PMC )0.97 BioGRID, IntAct, MINT STK26 Affinity Capture-MS, Co-fractionation, Two-hybrid physical 18782753 , 23455922 , 25416956 , 26344197 , 28514442 , (Europe PMC )NA BioGRID STK26 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, bio-layer interferometry, molecular sieving, pull down, surface plasmon resonance, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, x-ray crystallography association, direct interaction, physical association 18782753 , 23455922 , 23541896 , 23665169 , (Europe PMC )0.74, 0.77 IntAct STRIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct STRN Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18782753 , 24366813 , 26496610 , 28514442 , (Europe PMC )0.49, 0.71 BioGRID, IntAct STRN3 Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 18782753 , 24366813 , 26496610 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct STRN4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct TATDN1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TRAF3IP3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 18782753 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct UBR7 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UNK Affinity Capture-RNA physical 25737280 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.53 BioGRID, IntAct VCL Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID
Statistics
