- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
FKBP4
Gene Name  | FKBP4 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 4LAW |
| Synonyms | FKBP4, FKBP52 | |
| Protein Name | FKBP4 | |
| Alternative Name(s) | Peptidyl-prolyl cis-trans isomerase FKBP4;PPIase FKBP4;5.2.1.8;51 kDa FK506-binding protein;FKBP51;52 kDa FK506-binding protein;52 kDa FKBP;FKBP-52;59 kDa immunophilin;p59;FK506-binding protein 4;FKBP-4;FKBP59;HSP-binding immunophilin;HBI;Immunophilin FKBP52;Rotamase;Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed; | |
| Protein Family | noSimilarity_annotations | |
| EntrezGene ID | 2288 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | Q02790 (protein sequence) | |
| Enzyme Class | 5.2.1.8 (BRENDA ) | |
| Molecular Weight | 51805 Dalton | |
| Protein Length | 459 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000004478 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0543 | eggNOG - COG0545 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytosol Mitochondrion Nucleus Cytoplasm, cytoskeleton Cell projection, axon Note=Shuttles from mitochondria tonucleus; co-localizes in mitochondria with the glucocorticoidreceptor (PubMed:21730050) Colocalized with MAPT/TAU in thedistal part of the primary cortical neurons (By similarity) | |||
| Function (UniProt annotation) | |||
| Immunophilin protein with PPIase and co-chaperoneactivities Component of steroid receptors heterocomplexes throughinteraction with heat-shock protein 90 (HSP90) May play a role inthe intracellular trafficking of heterooligomeric forms of steroidhormone receptors between cytoplasm and nuclear compartments Theisomerase activity controls neuronal growth cones via regulationof TRPC1 channel opening Acts also as a regulator of microtubuledynamics by inhibiting MAPT/TAU ability to promote microtubuleassembly May have a protective role against oxidative stress inmitochondria | |||
| Catalytic Activity (UniProt annotation) | |||
| Peptidylproline (omega=180) = peptidylproline(omega=0) | |||
| Protein Sequence | |||
| MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFD LGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEG YAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPN AELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLA SHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRI RRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0003723 | F:RNA binding |
| GO:0003755 | F:peptidyl-prolyl cis-trans isomerase activity |
| GO:0005524 | F:ATP binding |
| GO:0005525 | F:GTP binding |
| GO:0005528 | F:FK506 binding |
| GO:0005654 | C:nucleoplasm |
| GO:0005737 | C:cytoplasm |
| GO:0005739 | C:mitochondrion |
| GO:0005829 | C:cytosol |
| GO:0005874 | C:microtubule |
| GO:0006457 | P:protein folding |
| GO:0006463 | P:steroid hormone receptor complex assembly |
| GO:0006825 | P:copper ion transport |
| GO:0007566 | P:embryo implantation |
| GO:0010977 | P:negative regulation of neuron projection development |
| GO:0030521 | P:androgen receptor signaling pathway |
| GO:0030674 | F:protein binding |
| GO:0030850 | bridging |
| GO:0031072 | P:prostate gland development |
| GO:0031111 | F:heat shock protein binding |
| GO:0031115 | P:negative regulation of microtubule polymerization or depolymerization |
| GO:0031503 | P:negative regulation of microtubule polymerization |
| GO:0032767 | P:protein-containing complex localization |
| GO:0032991 | F:copper-dependent protein binding |
| GO:0035259 | C:protein-containing complex |
| GO:0043025 | F:glucocorticoid receptor binding |
| GO:0044295 | C:neuronal cell body |
| GO:0046661 | C:axonal growth cone |
| GO:0048156 | P:male sex differentiation |
| GO:0048471 | F:tau protein binding |
| GO:0051219 | C:perinuclear region of cytoplasm |
| GO:0061077 | F:phosphoprotein binding |
| GO:0070062 | P:chaperone-mediated protein folding |
| GO:1900034 | C:extracellular exosome |
FKBP4 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in FKBP4 (Q02790) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTPN2 | P17706 | NA | In vivo | 12552015, | Europe PMC |  |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04915 | Estrogen signaling pathway | Estrogens are steroid hormones that regulate a plethora of physiological processes in mammals, including reproduction, cardiovascular protection, bone integrity, cellular homeostasis, and behavior. Estrogen mediates its cellular actions through two signaling pathways classified as nuclear-initiated steroid signalingand membrane-initiated steroid signaling. In the nuclearpathway, estrogen binds either ERalpha or ERbeta, which in turn translocates to the nucleus, binds DNA at ERE elements and activates the expression of ERE-dependent genes. In membranepathway, Estrogen can exert its actions through a subpopulation of ER at the plasma membrane (mER) or novel G-protein coupled E2 receptors (GPER). Upon activation of these receptors various signaling pathways (i.e. Ca2+, cAMP, protein kinase cascades) are rapidly activated and ultimately influence downstream transcription factors. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-3371497 | HSP90 chaperone cycle for steroid hormone receptors (SHR). | Steroid hormone receptors (SHR) are transcription factors that become activated upon sensing steroid hormones such as glucocorticoids, mineralocorticoids, progesterone, androgens, or estrogen (Escriva et al 2000; Griekspoor A et al. 2007; Eick GN & Thornton JW. 2011). Depending on SHR type and the presence of ligand, they show different subcellular localizations. Whereas both unliganded and liganded estrogen receptors (ERalpha and ERbeta) are predominantly nuclear, unliganded glucocorticoid (GR) and androgen receptors (AR) are mostly located in the cytoplasm and completely translocate to the nucleus only after binding hormone (Htun H et al. 1999; Stenoien D et al. 2000; Tyagi RK et al. 2000; Cadepond F et al. 1992; Jewell CM et al. 1995; Kumar S et al. 2006). The unliganded mineralocorticoid receptor (MR) is partially cytoplasmic but can be found in nucleus in the ligand-bound or ligand-free form (Nishi M & Kawata M 2007). The progesterone receptor (PR) exists in two forms (PRA and PRB) with different ratios of nuclear versus cytoplasmic localization of the unliganded receptor. In most cell contexts, the PRA isoform is a repressor of the shorter PRB isoform, and without hormone induction it is mostly located in the nucleus, whereas PRB distributes both in the nucleus and in the cytoplasm (Lim CS et al. 1999; Griekspoor A et al. 2007). In the absence of ligand, members of the steroid receptor family remain sequestered in the cytoplasm and/or nucleus in the complex with proteins of HSP70/HSP90 chaperone machinery (Pratt WB & Dittmar KD1998). The highly dynamic ATP-dependent interactions of SHRs with HSP90 complexes regulate SHR cellular location, protein stability, competency to bind steroid hormones and transcriptional activity (Echeverria PC & Picard D 2010). Understanding the mechanism of ATPase activity of HSP90 is mostly based on structural and functional studies of the Saccharomyces cerevisiae Hsp90 complexes (Meyer P et al. 2003, 2004; Ali MM et al. 2006; Prodromou C et al. 2000; Prodromou C 2012). The ATPase cycle of human HSP90 is less well understood, however several studies suggest that the underlying enzymatic mechanisms and a set of conformational changes that accompany the ATPase cycle are highly similar in both species (Richter K et al. 2008; Vaughan CK et al. 2009). Nascent SHR proteins are chaperoned by HSP70 and HSP40 to HSP90 cycle via STIP1 (HOP) (and its TPR domains) (Hernández MP et al. 2002a,b; EcheverriaPC & Picard D 2010; Li J et al. 2011). The ATP-bound form of HSP90 leads to the displacement of STIP1 by immunophilins FKBP5 or FKBP4 resulting in conformational changes that allow efficient hormone binding (Li J et al. 2011). PTGES3 (p23) binds to HSP90 complex finally stabilizing it in the conformation with a high hormone binding affinity. After hydrolysis of ATP the hormone bound SHR is released from HSP90 complex. The cytosolic hormone-bound SHR can be transported to the nucleus by several import pathways such as the dynein-based nuclear transport along microtubules involving the transport of the entire HSP90 complex or nuclear localization signals (NLS)-mediated nuclear targeting by importins (Tyagi RK et al. 2000; Cadepond F et al. 1992; Jewell CM et al. 1995; Kumar S et al. 2006). It is worth noting that GR-importin interactions can be ligand-dependent or independent (Freedman & Yamamoto 2004; Picard & Yamamoto 1987). In the nucleus ligand-activated SHR dimerizes, binds specific sequences in the DNA, called Hormone Responsive Elements (HRE), and recruits a number of coregulators that facilitate gene transcription. Nuclear localization is essential for SHRs to transactivate their target genes, but the same receptors also possess non-genomic functions in the cytoplasm. The Reactome module describes the ATPase-driven conformational cycle of HSP90 that regulates ligand-dependent activation of SHRs |
| R-HSA-3371568 | Attenuation phase. | Attenuation of the heat shock transcriptional response occurs during continuous exposure to intermediate heat shock conditions or upon recovery from stress (Abravaya et al. 1991). The attenuation phase of HSF1 cycle involves the transcriptional silencing of HSF1 bound to HSE, the release of HSF1 trimers from HSE and dissociation of HSF1 trimers to monomers. HSF1-driven heat stress associated transcription was shown to depend on inducible and reversible acetylation of HSF1 at Lys80, which negatively regulates DNA binding activity of HSF1 (Westerheide SD et al. 2009). In addition, the attenuation of HSF1 activation takes place when enough HSP70/HSP40 is produced to saturate exposed hydrophobic regions of proteins damaged as a result of heat exposure. The excess HSP70/HSP40 binds to HSF1 trimer, which leads to its dissociation from the promoter and conversion to the inactive monomeric form (Abravaya et al. 1991; Shi Y et al. 1998). Interaction of HSP70 with the transcriptional corepressor repressor element 1-silencing transcription factor corepressor (CoREST) assists in terminating heat-shock response (Gomez AV et al. 2008). HSF1 DNA-binding and transactivation activity were also inhibited upon interaction of HSF1-binding protein (HSBP1) with active trimeric HSF1(Satyal SH et al. 1998) |
| R-HSA-8939211 | ESR-mediated signaling. | Estrogens are a class of hormones that play a role in physiological processes such as development, reproduction, metabolism of liver, fat and bone, and neuronal and cardiovascular function (reviewed in Arnal et al, 2017; Haldosen et al, 2014). Estrogens bind estrogen receptors, members of the nuclear receptor superfamily. Ligand-bound estrogen receptors act as nuclear transcription factors to regulate expression of genes that control cellular proliferation and differentiation, among other processes (reviewed in Hah et al, 2014) |
| R-HSA-9018519 | Estrogen-dependent gene expression. | Estrogens mediate their transcriptional effects through interaction with the estrogen receptors, ESR1 (also known as ER alpha) and ESR2 (ER beta). ESR1 and ESR2 share overlapping but distinct functions, with ESR1 playing the primary role in transcriptional activation in most cell types (Hah and Krauss, 2014; Haldosén et al, 2014. The receptors function as ligand-dependent dimers and can activate target genes either through direct binding to an estrogen responsive element (ERE) in the target gene promoter, or indirectly through interaction with another DNA-binding protein such as RUNX1, SP1, AP1 or NF-kappa beta (reviewed in Bai and Gust, 2009; Hah and Krause, 2014). Binding of estrogen receptors to the DNA promotes the assembly of higher order transcriptional complexes containing methyltransferases, histone acetyltransferases and other transcriptional activators, which promote transcription by establishing active chromatin marks and by recruiting general transcription factors and RNA polymerase II. ESR1- and estrogen-dependent recruitment of up to hundreds of coregulators has been demonstrated by varied co-immunoprecipitation and proteomic approaches (Kittler et al, 2013; Mohammed et al, 2013; Foulds et al, 2013; Mohammed et al, 2015; Liu et al, 2014; reviewed in Magnani and Lupien, 2014; Arnal, 2017). In some circumstances, ligand-bound receptors can also promote the assembly of a repression complex at a target gene, and in some cases, heterodimers of ESR1 and ESR2 serve as repressors of ESR1-mediated target gene activation (reviewed in Hah and Kraus, 2014; Arnal et al, 2017). Phosphorylation of the estrogen receptor also modulates its activity, and provides cross-talk between nuclear estrogen-dependent signaling and non-genomic estrogen signaling from the plasma membrane (reviewed in Anbalagan and Rowan, 2015; Halodsèn et al, 2014; Schwartz et al, 2016) A number of recent genome wide studies highlight the breadth of the transcriptional response to estrogen. The number of predicted estrogen-dependent target genes ranges from a couple of hundred (based on microarray studies) to upwards of 10000, based on ChIP-chip or ChIP-seq (Cheung and Kraus, 2010; Kinnis and Kraus, 2008; Lin et al, 2004; Welboren et al, 2009; Ikeda et al, 2015; Lin et al, 2007; Carroll et al, 2006). Many of these predicted sites may not represent transcriptionally productive binding events, however. A study examining ESR1 binding by ChIP-seq in 20 primary breast cancers identified a core of 484 ESR-binding events that were conserved in at least 75% of ER+ tumors, which may represent a more realistic estimate (Ross-Innes et al, 2012). These studies also highlight the long-range effect of estrogen receptor-binding, with distal enhancer or promoter elements regulating the expression of many target genes, often through looping or other higher order chromatin structures (Kittler et al, 2013; reviewed in Dietz and Carroll, 2008; Liu and Cheung, 2014; Magnani and Lupien, 2014). Transcription from a number of estrogen-responsive target genes also appears to be primed by the binding of pioneering transcription factors such as FOXA1, GATA3, PBX1 among others |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AR | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical, physical association | 20661446, 21730179, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ATG101 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| CACYBP | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CALM1 | Reconstituted Complex | physical | 7887964, (Europe PMC) | NA | BioGRID |
| CDC37 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| CDC37L1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CEP290 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHORDC1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| DDA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 20029029, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGLN1 | Affinity Capture-MS | physical | 23413029, (Europe PMC) | NA | BioGRID |
| ESR1 | Reconstituted Complex | physical | 9222609, (Europe PMC) | NA | BioGRID |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| FBXW11 | Affinity Capture-MS | physical | 25515538, (Europe PMC) | NA | BioGRID |
| FES | Reconstituted Complex | physical | 9222609, (Europe PMC) | NA | BioGRID |
| FOXO3 | Affinity Capture-MS | physical | 20562859, (Europe PMC) | NA | BioGRID |
| GABARAP | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GLMN | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 10051602, 11164950, 12604780, 25036637, 8955134, (Europe PMC) | 0.62 | BioGRID, IntAct |
| HSF1 | Affinity Capture-Western, Reconstituted Complex | physical | 11583998, 9222609, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti tag coimmunoprecipitation, pull down, tandem affinity purification | association, direct interaction, physical | 10642522, 19875381, 20188096, 20661446, 21170051, 21360678, 22504172, 22678819, 22863883, 25036637, 28514442, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| HSP90AA5P | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation in solution | association, direct interaction, physical, physical association | 21170051, 21730179, 25036637, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct |
| HSP90AB4P | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HSPA4 | Reconstituted Complex | physical | 10642522, (Europe PMC) | NA | BioGRID |
| HSPB1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IKBKB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRF4 | Affinity Capture-Western | physical | 10714679, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| LCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LOXHD1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LSM7 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPT | Affinity Capture-Western, far western blotting | direct interaction, physical | 20133804, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MCM4 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MGME1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MKS1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NEK8 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NIPSNAP2 | Affinity Capture-MS | physical | 20562859, (Europe PMC) | NA | BioGRID |
| NPB | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NPHP1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NPHP4 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NR3C1 | Affinity Capture-Western, Reconstituted Complex | physical | 16131566, 20661446, 8341706, (Europe PMC) | NA | BioGRID |
| NR3C2 | Affinity Capture-Western | physical | 20661446, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| OFD1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OGA | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PGR | Affinity Capture-Western | physical | 20661446, (Europe PMC) | NA | BioGRID |
| PHLPP1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PHYH | Reconstituted Complex, Two-hybrid | physical | 10051602, (Europe PMC) | NA | BioGRID |
| PIK3C2A | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PLS1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| POC1A | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPEF2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PRKAB1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRKAG1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRKAG2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PTGES3 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 11413142, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RIPK3 | Affinity Capture-MS | physical | 21903422, (Europe PMC) | NA | BioGRID |
| RPGR | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS10-NUDT3 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 25036637, (Europe PMC) | NA | BioGRID |
| S100A1 | Affinity Capture-Western, Reconstituted Complex | physical | 20188096, (Europe PMC) | NA | BioGRID |
| S100A2 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| S100A6 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| SAE1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SARDH | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SH3BP4 | Two-hybrid, two hybrid | physical, physical association | 18654987, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3GLB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SNCA | Protein-peptide | physical | 17893145, (Europe PMC) | NA | BioGRID |
| SQSTM1 | Reconstituted Complex | physical | 14702098, (Europe PMC) | NA | BioGRID |
| STIL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STIP1 | Reconstituted Complex, cosedimentation in solution | physical, physical association | 21170051, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SUGT1 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 25036637, (Europe PMC) | NA | BioGRID |
| TAF9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TPM3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UBA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP19 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AHSA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 22504172, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AR | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical, physical association | 20661446, 21730179, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ATG101 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CACYBP | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC37 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| CDC37L1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CEP290 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHEK2 | tandem affinity purification | association | 23178491, (Europe PMC) | 0.35 | IntAct |
| CHORDC1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 20029029, (Europe PMC) | 0.37 | BioGRID, IntAct |
| FOXO3 | anti tag coimmunoprecipitation | physical association | 20562859, (Europe PMC) | 0.40 | IntAct |
| GABARAP | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GLMN | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 10051602, 11164950, 12604780, 25036637, 8955134, (Europe PMC) | 0.62 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti tag coimmunoprecipitation, pull down, tandem affinity purification | association, direct interaction, physical | 10642522, 19875381, 20188096, 20661446, 21170051, 21360678, 22504172, 22678819, 22863883, 25036637, 28514442, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| HSP90AB1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation in solution | association, direct interaction, physical, physical association | 21170051, 21730179, 25036637, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct |
| HSPB1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IFI16 | anti tag coimmunoprecipitation | association | 25665578, (Europe PMC) | 0.35 | IntAct |
| IKBKB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LOXHD1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LSM7 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPT | Affinity Capture-Western, far western blotting | direct interaction, physical | 20133804, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MKS1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NEK8 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NIPSNAP2 | anti tag coimmunoprecipitation | physical association | 20562859, (Europe PMC) | 0.40 | IntAct |
| NPHP1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NPHP4 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NUDCD3 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| OFD1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OTUB1 | anti tag coimmunoprecipitation | association | 26752685, (Europe PMC) | 0.35 | IntAct |
| PHOSPHO1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PIK3C2A | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| POC1A | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRKAG1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRKAG2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PTGES3 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 11413142, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPGR | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| S100A2 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| S100A6 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| SAE1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SH3BP4 | Two-hybrid, two hybrid | physical, physical association | 18654987, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3GLB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| STIL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STIP1 | Reconstituted Complex, cosedimentation in solution | physical, physical association | 21170051, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SUGT1 | anti tag coimmunoprecipitation | association | 25036637, (Europe PMC) | 0.35 | IntAct |
| UBA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP19 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| S100A2 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| S100A6 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AHSA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical | 22504172, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AR | Affinity Capture-Western, anti bait coimmunoprecipitation | association, physical, physical association | 20661446, 21730179, (Europe PMC) | 0.50 | BioGRID, IntAct |
| ATG101 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| CACYBP | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CALM1 | Reconstituted Complex | physical | 7887964, (Europe PMC) | NA | BioGRID |
| CDC37 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping | association, physical, physical association | 25036637, (Europe PMC) | 0.50 | BioGRID, IntAct |
| CDC37L1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CEP290 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CHEK2 | tandem affinity purification | association | 23178491, (Europe PMC) | 0.35 | IntAct |
| CHORDC1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| DDA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 20029029, (Europe PMC) | 0.37 | BioGRID, IntAct |
| EGLN1 | Affinity Capture-MS | physical | 23413029, (Europe PMC) | NA | BioGRID |
| ESR1 | Reconstituted Complex | physical | 9222609, (Europe PMC) | NA | BioGRID |
| EWSR1 | Proximity Label-MS | physical | 24999758, (Europe PMC) | NA | BioGRID |
| FBXW11 | Affinity Capture-MS | physical | 25515538, (Europe PMC) | NA | BioGRID |
| FES | Reconstituted Complex | physical | 9222609, (Europe PMC) | NA | BioGRID |
| FOXO3 | Affinity Capture-MS | physical | 20562859, (Europe PMC) | NA | BioGRID |
| FOXO3 | anti tag coimmunoprecipitation | physical association | 20562859, (Europe PMC) | 0.40 | IntAct |
| GABARAP | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GLMN | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 10051602, 11164950, 12604780, 25036637, 8955134, (Europe PMC) | 0.62 | BioGRID, IntAct |
| HSF1 | Affinity Capture-Western, Reconstituted Complex | physical | 11583998, 9222609, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti tag coimmunoprecipitation, pull down, tandem affinity purification | association, direct interaction, physical | 10642522, 19875381, 20188096, 20661446, 21170051, 21360678, 22504172, 22678819, 22863883, 25036637, 28514442, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| HSP90AA5P | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-Luminescence, Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation in solution | association, direct interaction, physical, physical association | 21170051, 21730179, 25036637, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct |
| HSP90AB4P | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| HSPA4 | Reconstituted Complex | physical | 10642522, (Europe PMC) | NA | BioGRID |
| HSPB1 | Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.51 | BioGRID, IntAct |
| IFI16 | anti tag coimmunoprecipitation | association | 25665578, (Europe PMC) | 0.35 | IntAct |
| IKBKB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 21903422, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IRF4 | Affinity Capture-Western | physical | 10714679, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| LCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LOXHD1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| LSM7 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPT | Affinity Capture-Western, far western blotting | direct interaction, physical | 20133804, (Europe PMC) | 0.44 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MCM4 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MGME1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| MKS1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NEK8 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NIPSNAP2 | Affinity Capture-MS | physical | 20562859, (Europe PMC) | NA | BioGRID |
| NIPSNAP2 | anti tag coimmunoprecipitation | physical association | 20562859, (Europe PMC) | 0.40 | IntAct |
| NPB | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| NPHP1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NPHP4 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NR3C1 | Affinity Capture-Western, Reconstituted Complex | physical | 16131566, 20661446, 8341706, (Europe PMC) | NA | BioGRID |
| NR3C2 | Affinity Capture-Western | physical | 20661446, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUDCD3 | luminescence based mammalian interactome mapping | physical association | 25036637, (Europe PMC) | 0.40 | IntAct |
| OFD1 | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| OGA | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| OTUB1 | anti tag coimmunoprecipitation | association | 26752685, (Europe PMC) | 0.35 | IntAct |
| PGR | Affinity Capture-Western | physical | 20661446, (Europe PMC) | NA | BioGRID |
| PHLPP1 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PHOSPHO1 | pull down | association | 28330616, (Europe PMC) | 0.35 | IntAct |
| PHYH | Reconstituted Complex, Two-hybrid | physical | 10051602, (Europe PMC) | NA | BioGRID |
| PIK3C2A | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PLS1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| POC1A | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPEF2 | Proximity Label-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PRKAB1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRKAG1 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PRKAG2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| PTGES3 | Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 11413142, 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RIPK3 | Affinity Capture-MS | physical | 21903422, (Europe PMC) | NA | BioGRID |
| RPGR | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS10-NUDT3 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 25036637, (Europe PMC) | NA | BioGRID |
| S100A1 | Affinity Capture-Western, Reconstituted Complex | physical | 20188096, (Europe PMC) | NA | BioGRID |
| S100A2 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| S100A6 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, competition binding, pull down | association, direct interaction, physical, physical association | 20188096, (Europe PMC) | 0.59 | BioGRID, IntAct, MINT |
| SAE1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SARDH | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SH3BP4 | Two-hybrid, two hybrid | physical, physical association | 18654987, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SH3GLB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SNCA | Protein-peptide | physical | 17893145, (Europe PMC) | NA | BioGRID |
| SQSTM1 | Reconstituted Complex | physical | 14702098, (Europe PMC) | NA | BioGRID |
| STIL | Proximity Label-MS, proximity-dependent biotin identification | association, physical | 26638075, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STIP1 | Reconstituted Complex, cosedimentation in solution | physical, physical association | 21170051, (Europe PMC) | 0.40 | BioGRID, IntAct |
| SUGT1 | Affinity Capture-Luminescence, Affinity Capture-MS | physical | 25036637, (Europe PMC) | NA | BioGRID |
| SUGT1 | anti tag coimmunoprecipitation | association | 25036637, (Europe PMC) | 0.35 | IntAct |
| TAF9 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TPM3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| UBA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | physical, physical association | 20562859, (Europe PMC) | 0.40 | BioGRID, IntAct |
| USP19 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| CSNK2A1 | T143_EFKGEDLtEEEDGGI, | in vitro | 9405642,(Europe PMC) | HPRD, |
| Unknown | S451_QKSNTAGsQSQVETE, S453_SNTAGSQsQVETEA, Y293_YKQALLQyKKIVSWL, Y411_LAREKKLyANMFERL, | HTP, in vivo | 16964243, 17525332, 18077418, 18669648, 18707149, 19413330, 20068231,(Europe PMC) | HPRD, PhosphoELM, |