- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
EEF2
Gene Name  | EEF2 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 4V6X |
| Synonyms | EEF2, EF2 | |
| Protein Name | EEF2 | |
| Alternative Name(s) | Elongation factor 2;EF-2; | |
| Protein Family | Belongs to the TRAFAC class translation factor GTPasesuperfamily Classic translation factor GTPase family EF-G/EF-2subfamily | |
| EntrezGene ID | 1938 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P13639 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 95338 Dalton | |
| Protein Length | 858 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000167658 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0469 | eggNOG - COG0480 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Note=Phosphorylation by CSKpromotes cleavage and SUMOylation-dependent nuclear translocationof the C-terminal cleavage product | |||
| Function (UniProt annotation) | |||
| Catalyzes the GTP-dependent ribosomal translocation stepduring translation elongation During this step, the ribosomechanges from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-boundpeptidyl-tRNA and P-site-bound deacylated tRNA move to the P and Esites, respectively Catalyzes the coordinated movement of the twotRNA molecules, the mRNA and conformational changes in theribosome | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYE LSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKM DRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG EGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKVFDAIMNFKKEETAKLIEKLD IKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISK MVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKD LEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYE WDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADL RSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0002039 | F:p53 binding |
| GO:0002244 | P:hematopoietic progenitor cell differentiation |
| GO:0002931 | P:response to ischemia |
| GO:0003009 | P:skeletal muscle contraction |
| GO:0003723 | F:RNA binding |
| GO:0003746 | F:translation elongation factor activity |
| GO:0003924 | F:GTPase activity |
| GO:0005525 | F:GTP binding |
| GO:0005576 | C:extracellular region |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0006414 | P:translational elongation |
| GO:0007568 | P:aging |
| GO:0008097 | F:5S rRNA binding |
| GO:0014009 | P:glial cell proliferation |
| GO:0016020 | C:membrane |
| GO:0016235 | C:aggresome |
| GO:0019901 | F:protein kinase binding |
| GO:0032355 | P:response to estradiol |
| GO:0034774 | C:secretory granule lumen |
| GO:0034976 | P:response to endoplasmic reticulum stress |
| GO:0035914 | P:skeletal muscle cell differentiation |
| GO:0042542 | P:response to hydrogen peroxide |
| GO:0042788 | C:polysomal ribosome |
| GO:0043022 | F:ribosome binding |
| GO:0043312 | P:neutrophil degranulation |
| GO:0045121 | C:membrane raft |
| GO:0045202 | C:synapse |
| GO:0045296 | F:cadherin binding |
| GO:0045471 | P:response to ethanol |
| GO:0045727 | P:positive regulation of translation |
| GO:0051015 | F:actin filament binding |
| GO:0051593 | P:response to folic acid |
| GO:0070062 | C:extracellular exosome |
| GO:1904813 | C:ficolin-1-rich granule lumen |
| GO:1990416 | P:cellular response to brain-derived neurotrophic factor stimulus |
| GO:1990904 | C:ribonucleoprotein complex |
| GO:2000767 | P:positive regulation of cytoplasmic translation |
EEF2 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in EEF2 (P13639) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP2CA | P67775 | Thr-57_GETRFtDTRKD,, Thr-59 _TRFTDtRKDEQ, | In vitro | 8386634, 2555220, 2176079, | Europe PMC |  |
| PPP2CB | P62714 | Thr-57_GETRFtDTRKD,, Thr-59 _TRFTDtRKDEQ, | In vitro | 8386634, 2555220, 2176079, | Europe PMC | |
| PPM1A | P35813 | Thr-57_GETRFtDTRKD,, Thr-59 _TRFTDtRKDEQ, | In vitro | 8386634, 7548224, 2176079, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04152 | AMPK signaling pathway | AMP-activated protein kinase (AMPK) is a serine threonine kinase that is highly conserved through evolution. AMPK system acts as a sensor of cellular energy status. It is activated by increases in the cellular AMP:ATP ratio caused by metabolic stresses that either interfere with ATP production (eg, deprivation for glucose or oxygen) or that accelerate ATP consumption (eg, muscle contraction). Several upstream kinases, including liver kinase B1 (LKB1), calcium/calmodulin kinase kinase-beta (CaMKK beta), and TGF-beta-activated kinase-1 (TAK-1), can activate AMPK by phosphorylating a threonine residue on its catalytic alpha-subunit. Once activated, AMPK leads to a concomitant inhibition of energy-consuming biosynthetic pathways, such as protein, fatty acid and glycogen synthesis, and activation of ATP-producing catabolic pathways, such as fatty acid oxidation and glycolysis. |
| hsa04921 | Oxytocin signaling pathway | Oxytocin (OT) is a nonapeptide synthesized by the magno-cellular neurons located in the supraoptic (SON) and paraventricular (PVN) nuclei of the hypothalamus. It exerts a wide variety of central and peripheral effects. However, its best-known and most well-established roles are stimulation of uterine contractions during parturition and milk release during lactation. Oxytocin also influences cardiovascular regulation and various social behaviors. The actions of OT are all mediated by one type of OT receptor (OTR). This is a transmembrane receptor belonging to the G-protein-coupled receptor superfamily. The main signaling pathway is the Gq/PLC/Ins3 pathway, but the MAPK and the RhoA/Rho kinase pathways are also activated, contributing to increased prostaglandin production and direct contractile effect on myometrial cells. In the cardiovascular system, OTR is associated with the ANP-cGMP and NO-cGMP pathways, which reduce the force and rate of contraction and increase vasodilatation. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-156902 | Peptide chain elongation. | The mechanism of a peptide bond requires the movement of three protons. First the deprotonation of the ammonium ion generates a reactive amine, allowing a nucleophilic attack on the carbonyl group. This is followed by the loss of a proton from the reaction intermediate, only to be taken up by the oxygen on the leaving group (from the end of the amino acid chain bound to the tRNA in the P-site). The peptide bond formation results in the net loss of one water molecule, leaving a deacylated-tRNA in the P-site, and a nascent polypeptide chain one amino acid larger in the A-site.For the purpose of illustration, the figures used in the section show one amino acid being added to a peptidyl-tRNA with a growing peptide chain |
| R-HSA-5336415 | Uptake and function of diphtheria toxin. | Diphtheria is a serious, often fatal human disease associated with damage to many tissues. Bacteria in infected individuals, however, are typically confined to the lining of the throat or to a skin lesion; systemic effects are due to the secretion of an exotoxin encoded by a lysogenic bacteriophage. The toxin is encoded as a single polypeptide but is cleaved by host furin-like proteases to yield an aminoterminal fragment A and a carboxyterminal fragment B, linked by a disulfide bond. Toxin cleavage can occur when it first contacts the target cell surface, as annotated here, or as late as the point at which fragment A is released into the cytosol. Fragment B mediates toxin uptake into target cell endocytic vesicles, where acidification promotes a conformational change enabling fragment B to form a channel in the vesicle membrane through which fragment A is extruded into the target cell cytosol. Cleavage of the inter-fragment disulfide bond frees DT fragment A, which catalyzes ADP ribosylation of the translation elongation factor 2 (EEF2) in a target cell, thereby blocking protein synthesis. Neither fragment is toxic to human cells by itself (Collier 1975; Pappenheim 1977; Murphy 2011) |
| R-HSA-5358493 | Synthesis of diphthamide-EEF2. | Eukaryotic elongation factor 2 (EEF2) catalyzes the GTP dependent ribosomal translocation step during translation elongation. This function requires the presence of a posttranslational modification, the conversion of histidine residue 715 to diphthamide (2' [3 carboxamido 3 (trimethylammonio)propyl] L histidine) (Van Ness et al. 1978). No other protein is known to undergo this modification. The diphthamide residue is also the target of ADP ribosylation catalyzed by diphtheria toxin, which inactivates EEF2 and leads to cell death (Collier 1975; Pappenheim 1977). Diphthamide synthesis proceeds in four steps: the transfer of 3 amino 3 carboxypropyl group from S adenosylmethionine to histidine 715 of EEF2, the addition of four methyl groups to the 3 amino 3 carboxypropyl moiety, the demethylation of the methylated carboxylate group to form diphthine, and the amidation of the diphthine carboxyl group (Liu et al. 2004; Lin et al. 2014; Schaffrath et al. 2014; Su et al. 2013; Uthman et al. 2013) |
| R-HSA-6798695 | Neutrophil degranulation. | Neutrophils are the most abundant leukocytes (white blood cells), indispensable in defending the body against invading microorganisms. In response to infection, neutrophils leave the circulation and migrate towards the inflammatory focus. They contain several subsets of granules that are mobilized to fuse with the cell membrane or phagosomal membrane, resulting in the exocytosis or exposure of membrane proteins. Traditionally, neutrophil granule constituents are described as antimicrobial or proteolytic, but granules also introduce membrane proteins to the cell surface, changing how the neutrophil responds to its environment (Borregaard et al. 2007). Primed neutrophils actively secrete cytokines and other inflammatory mediators and can present antigens via MHC II, stimulating T-cells (Wright et al. 2010).Granules form during neutrophil differentiation. Granule subtypes can be distinguished by their content but overlap in structure and composition. The differences are believed to be a consequence of changing protein expression and differential timing of granule formation during the terminal processes of neutrophil differentiation, rather than sorting (Le Cabec et al. 1996). The classical granule subsets are Azurophil or primary granules (AG), secondary granules (SG) and gelatinase granules (GG). Neutrophils also contain exocytosable storage cell organelles, storage vesicles (SV), formed by endocytosis they contain many cell-surface markers and extracellular, plasma proteins (Borregaard et al. 1992). Ficolin-1-rich granules (FG) are like GGs highly exocytosable but gelatinase-poor (Rorvig et al. 2009) |
| R-HSA-8876725 | Protein methylation. | Methylation of lysine (Lys) and arginine (Arg) residues on non-histone proteins is a prevalent post-translational modification and important regulator of cellular signal transduction pathways including MAPK, WNT, BMP, Hippo and JAK–STAT. Crosstalk between methylation and other types of post-translational modifications and between histone and non-histone protein methylation is frequent, affecting cellular functions such as chromatin remodelling, gene transcription, protein synthesis, signal transduction and DNA repair (Biggar & Li 2015) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABCD3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ADRB2 | Affinity Capture-MS | physical | 23798571, (Europe PMC) | NA | BioGRID |
| AHNAK | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARPC2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATIC | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATP1B3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATP6V1H | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| AURKA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| BLK | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BUB1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BZW1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CALR | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CAPN1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CASK | Affinity Capture-MS | physical | 25852190, (Europe PMC) | NA | BioGRID |
| CASP3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CASP7 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CCT2 | Reconstituted Complex | physical | 23190606, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDH1 | Proximity Label-MS | physical | 25468996, (Europe PMC) | NA | BioGRID |
| CDK13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK18 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CDK20 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDKN2A | Reconstituted Complex | physical | 17955473, (Europe PMC) | NA | BioGRID |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CKB | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| COPS6 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CRY1 | Affinity Capture-MS | physical | 25756610, (Europe PMC) | NA | BioGRID |
| CRY2 | Affinity Capture-MS | physical | 25756610, (Europe PMC) | NA | BioGRID |
| CSE1L | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL4B | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAPK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| DEFA1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DISC1 | Two-hybrid, two hybrid | physical, physical association | 17043677, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DPH1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DPH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF1A1 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| EEF1A2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF2K | Biochemical Activity | physical | 22669845, (Europe PMC) | NA | BioGRID |
| EEF2KMT | Affinity Capture-MS, Biochemical Activity | physical | 23349634, 25231979, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EIF4A1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF4H | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ENO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EP300 | Reconstituted Complex, anti bait coimmunoprecipitation | association, physical | 20808282, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| EPHA2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ERLIN2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ESR1 | Reconstituted Complex | physical | 20348541, (Europe PMC) | NA | BioGRID |
| FARSA | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FBXO9 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FLOT2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FTO | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FUS | Affinity Capture-MS | physical | 25192599, (Europe PMC) | NA | BioGRID |
| GAN | Affinity Capture-MS | physical | 26460568, (Europe PMC) | NA | BioGRID |
| GINS2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| GSPT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GSR | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HCFC1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HDAC6 | Affinity Capture-MS | physical | 26643866, (Europe PMC) | NA | BioGRID |
| HDGF | Affinity Capture-MS | physical | 21907836, (Europe PMC) | NA | BioGRID |
| HIPK4 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA0 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HNRNPA3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPD | Two-hybrid | physical | 15231747, (Europe PMC) | NA | BioGRID |
| HNRNPDL | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPH1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPL | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HSD17B10 | Affinity Capture-MS, Co-fractionation, blue native page, cross-linking study | association, physical, physical association | 26344197, 29128334, (Europe PMC) | 0.50 | BioGRID, IntAct |
| HSD17B4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-MS | physical | 16263121, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| HSPA8 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HSPD1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HUWE1 | Affinity Capture-MS | physical | 25147182, (Europe PMC) | NA | BioGRID |
| IPO4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| ISYNA1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| LGR4 | Affinity Capture-MS | physical | 24639526, (Europe PMC) | NA | BioGRID |
| LIMK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAPK14 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAT2A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MDM2 | Affinity Capture-RNA | physical | 24798327, (Europe PMC) | NA | BioGRID |
| MLH1 | Two-hybrid, two hybrid | physical, physical association | 20706999, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MLLT3 | Affinity Capture-MS | physical | 20431927, (Europe PMC) | NA | BioGRID |
| MRPS5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| NDRG1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17220478, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NDUFV1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NFATC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NOP56 | Affinity Capture-MS | physical | 12777385, (Europe PMC) | NA | BioGRID |
| NOTCH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUP62 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| OPA1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PABPC1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PAK2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PARK7 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PFAS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PGD | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PGK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| POU5F1 | Affinity Capture-RNA | physical | 21151833, (Europe PMC) | NA | BioGRID |
| PPME1 | Affinity Capture-MS | physical | 26499835, (Europe PMC) | NA | BioGRID |
| PPP2R1A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17540176, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2R1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17540176, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMA3 | Affinity Capture-MS | physical | 22079093, (Europe PMC) | NA | BioGRID |
| PTEN | Reconstituted Complex | physical | 26561776, (Europe PMC) | NA | BioGRID |
| RAD23A | Affinity Capture-MS, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RBM4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RDX | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RHOT2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RPL10A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL10L | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL11 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL12 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL14 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL18 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL21 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL23 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL31 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL7A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPLP0P6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS15A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS16 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS19 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS23 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS24 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS3A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS4X | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| RPS7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RRM1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SDHA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEM1 | Affinity Capture-MS | physical | 24515614, (Europe PMC) | NA | BioGRID |
| SENP3 | Affinity Capture-MS | physical | 26511642, (Europe PMC) | NA | BioGRID |
| SIRT6 | Affinity Capture-MS | physical | 24169447, (Europe PMC) | NA | BioGRID |
| SLC25A48 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SMG1 | Affinity Capture-MS, pull down | association, physical | 20371770, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SOAT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SOD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TAGLN | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TAGLN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TARDBP | Affinity Capture-MS | physical | 20020773, (Europe PMC) | NA | BioGRID |
| TARS | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TOMM40 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 12891704, 22653443, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| TRIM25 | Affinity Capture-MS | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TUBB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TXN | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TYMP | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, (Europe PMC) | NA | BioGRID |
| UBL4A | Affinity Capture-MS | physical | 23246001, (Europe PMC) | NA | BioGRID |
| UCHL5 | Reconstituted Complex | physical | 21800051, (Europe PMC) | NA | BioGRID |
| UNK | Affinity Capture-RNA | physical | 25737280, (Europe PMC) | NA | BioGRID |
| UPF1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical | 19417104, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VDAC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WEE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WWP2 | Affinity Capture-MS | physical | 25071155, (Europe PMC) | NA | BioGRID |
| XPO1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| XRCC6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| YWHAQ | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BLK | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BUB1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK18 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK20 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDKN2A | pull down | association | 17955473, (Europe PMC) | 0.35 | IntAct |
| DAPK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DISC1 | Two-hybrid, two hybrid | physical, physical association | 17043677, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| EHMT2 | anti tag coimmunoprecipitation | association | 26028330, (Europe PMC) | 0.35 | IntAct |
| EP300 | Reconstituted Complex, anti bait coimmunoprecipitation | association, physical | 20808282, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| HIPK4 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSD17B10 | Affinity Capture-MS, Co-fractionation, blue native page, cross-linking study | association, physical, physical association | 26344197, 29128334, (Europe PMC) | 0.50 | BioGRID, IntAct |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| HSPB2 | two hybrid | physical association | 26465331, (Europe PMC) | 0.37 | IntAct |
| IFT88 | anti tag coimmunoprecipitation | association | 27173435, (Europe PMC) | 0.35 | IntAct |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LIMK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK2 | tandem affinity purification | association | 24725412, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAPK13 | anti tag coimmunoprecipitation | association | 19135240, (Europe PMC) | 0.35 | IntAct |
| MAPK14 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAX | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| MLH1 | Two-hybrid, two hybrid | physical, physical association | 20706999, (Europe PMC) | 0.37 | BioGRID, IntAct |
| NDRG1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17220478, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NEDD8 | tandem affinity purification | association | 18274552, (Europe PMC) | 0.35 | IntAct, MINT |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| OTUB1 | anti tag coimmunoprecipitation | association | 26752685, (Europe PMC) | 0.35 | IntAct |
| PARK7 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PPP1R15A | anti tag coimmunoprecipitation | association | 29109149, (Europe PMC) | 0.35 | IntAct |
| PPP2R1A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17540176, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2R1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17540176, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAD23A | Affinity Capture-MS, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| SDHA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SMG1 | Affinity Capture-MS, pull down | association, physical | 20371770, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SOAT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SOD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUN2 | pull down | association | 22555292, (Europe PMC) | 0.35 | IntAct |
| TP53 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 12891704, 22653443, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| UPF1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical | 19417104, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VDAC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WEE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| ZMYM1 | anti tag coimmunoprecipitation | association | 25852190, (Europe PMC) | 0.35 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| EP300 | Reconstituted Complex, anti bait coimmunoprecipitation | association, physical | 20808282, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| NEDD8 | tandem affinity purification | association | 18274552, (Europe PMC) | 0.35 | IntAct, MINT |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| RAD23A | Affinity Capture-MS, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| TP53 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 12891704, 22653443, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ABCD3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ADRB2 | Affinity Capture-MS | physical | 23798571, (Europe PMC) | NA | BioGRID |
| AHNAK | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| APEX1 | affinity chromatography technology | association | 20808282, (Europe PMC) | 0.35 | IntAct, MINT |
| ARAF | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARPC2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARRB2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17620599, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATIC | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATP1B3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATP6V1H | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| AURKA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| BLK | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BRCA1 | Affinity Capture-MS | physical | 26831064, (Europe PMC) | NA | BioGRID |
| BUB1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BZW1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CALR | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CAPN1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CASK | Affinity Capture-MS | physical | 25852190, (Europe PMC) | NA | BioGRID |
| CASP3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CASP7 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CCT2 | Reconstituted Complex | physical | 23190606, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDH1 | Proximity Label-MS | physical | 25468996, (Europe PMC) | NA | BioGRID |
| CDK13 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK18 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CDK20 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDKN2A | Reconstituted Complex | physical | 17955473, (Europe PMC) | NA | BioGRID |
| CDKN2A | pull down | association | 17955473, (Europe PMC) | 0.35 | IntAct |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CKB | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| COPS6 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CRY1 | Affinity Capture-MS | physical | 25756610, (Europe PMC) | NA | BioGRID |
| CRY2 | Affinity Capture-MS | physical | 25756610, (Europe PMC) | NA | BioGRID |
| CSE1L | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CUL1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL4B | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CUL5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAPK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| DEFA1 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DISC1 | Two-hybrid, two hybrid | physical, physical association | 17043677, (Europe PMC) | 0.37 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLST | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DPH1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DPH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| EEF1A1 | Co-fractionation | physical | 22939629, 26344197, (Europe PMC) | NA | BioGRID |
| EEF1A2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EEF2K | Biochemical Activity | physical | 22669845, (Europe PMC) | NA | BioGRID |
| EEF2KMT | Affinity Capture-MS, Biochemical Activity | physical | 23349634, 25231979, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| EHMT2 | anti tag coimmunoprecipitation | association | 26028330, (Europe PMC) | 0.35 | IntAct |
| EIF4A1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| EIF4H | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ENO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EP300 | Reconstituted Complex, anti bait coimmunoprecipitation | association, physical | 20808282, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| EPHA2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ERLIN2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| ESR1 | Reconstituted Complex | physical | 20348541, (Europe PMC) | NA | BioGRID |
| FARSA | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FBXO9 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| FLOT2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FTO | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FUS | Affinity Capture-MS | physical | 25192599, (Europe PMC) | NA | BioGRID |
| GABARAP | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GABARAPL2 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GAN | Affinity Capture-MS | physical | 26460568, (Europe PMC) | NA | BioGRID |
| GINS2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| GSPT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GSR | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| HCFC1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HDAC6 | Affinity Capture-MS | physical | 26643866, (Europe PMC) | NA | BioGRID |
| HDGF | Affinity Capture-MS | physical | 21907836, (Europe PMC) | NA | BioGRID |
| HIPK4 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA0 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HNRNPA3 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPD | Two-hybrid | physical | 15231747, (Europe PMC) | NA | BioGRID |
| HNRNPDL | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPH1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HNRNPL | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HSD17B10 | Affinity Capture-MS, Co-fractionation, blue native page, cross-linking study | association, physical, physical association | 26344197, 29128334, (Europe PMC) | 0.50 | BioGRID, IntAct |
| HSD17B4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSP90AA1 | Affinity Capture-MS | physical | 16263121, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| HSPA8 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HSPB2 | two hybrid | physical association | 26465331, (Europe PMC) | 0.37 | IntAct |
| HSPD1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| HUWE1 | Affinity Capture-MS | physical | 25147182, (Europe PMC) | NA | BioGRID |
| IFT88 | anti tag coimmunoprecipitation | association | 27173435, (Europe PMC) | 0.35 | IntAct |
| IPO4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| IRAK1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| ISYNA1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| LGR4 | Affinity Capture-MS | physical | 24639526, (Europe PMC) | NA | BioGRID |
| LIMK2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK2 | tandem affinity purification | association | 24725412, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAP1LC3B | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAPK13 | anti tag coimmunoprecipitation | association | 19135240, (Europe PMC) | 0.35 | IntAct |
| MAPK14 | Affinity Capture-MS, tandem affinity purification | association, physical | 23602568, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MAT2A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MAX | display technology | physical association | 20195357, (Europe PMC) | 0.40 | IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MDM2 | Affinity Capture-RNA | physical | 24798327, (Europe PMC) | NA | BioGRID |
| MLH1 | Two-hybrid, two hybrid | physical, physical association | 20706999, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MLLT3 | Affinity Capture-MS | physical | 20431927, (Europe PMC) | NA | BioGRID |
| MRPS5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| NDRG1 | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17220478, (Europe PMC) | 0.40 | BioGRID, IntAct |
| NDUFV1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NEDD8 | tandem affinity purification | association | 18274552, (Europe PMC) | 0.35 | IntAct, MINT |
| NFATC2 | Affinity Capture-MS | physical | 27637333, (Europe PMC) | NA | BioGRID |
| NOP56 | Affinity Capture-MS | physical | 12777385, (Europe PMC) | NA | BioGRID |
| NOTCH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUP62 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| OPA1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| OTUB1 | anti tag coimmunoprecipitation | association | 26752685, (Europe PMC) | 0.35 | IntAct |
| PABPC1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| PAK2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PARK7 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PARK7 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PFAS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PGD | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PGK1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| POU5F1 | Affinity Capture-RNA | physical | 21151833, (Europe PMC) | NA | BioGRID |
| PPME1 | Affinity Capture-MS | physical | 26499835, (Europe PMC) | NA | BioGRID |
| PPP1R15A | anti tag coimmunoprecipitation | association | 29109149, (Europe PMC) | 0.35 | IntAct |
| PPP2R1A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17540176, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2R1B | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 17540176, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMA3 | Affinity Capture-MS | physical | 22079093, (Europe PMC) | NA | BioGRID |
| PTEN | Reconstituted Complex | physical | 26561776, (Europe PMC) | NA | BioGRID |
| RAD23A | Affinity Capture-MS, pull down | physical, physical association | 16712842, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| RBM4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RDX | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RHOT2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RNF2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| RPL10A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL10L | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL11 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL12 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL14 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL18 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL21 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL23 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL31 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL4 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPL7A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPLP0P6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS15A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS16 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS19 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS23 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS24 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS3A | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS4X | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS5 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| RPS7 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| RRM1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| SDHA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SEM1 | Affinity Capture-MS | physical | 24515614, (Europe PMC) | NA | BioGRID |
| SENP3 | Affinity Capture-MS | physical | 26511642, (Europe PMC) | NA | BioGRID |
| SIRT6 | Affinity Capture-MS | physical | 24169447, (Europe PMC) | NA | BioGRID |
| SLC25A48 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| SMG1 | Affinity Capture-MS, pull down | association, physical | 20371770, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SOAT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SOD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUN2 | pull down | association | 22555292, (Europe PMC) | 0.35 | IntAct |
| TAGLN | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TAGLN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TARDBP | Affinity Capture-MS | physical | 20020773, (Europe PMC) | NA | BioGRID |
| TARS | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| TOMM40 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-Western, anti tag coimmunoprecipitation | association, physical | 12891704, 22653443, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| TRIM25 | Affinity Capture-MS | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TUBA1A | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TUBB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TUBB3 | pull down | association | 27291054, (Europe PMC) | 0.35 | IntAct |
| TXN | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TYMP | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, (Europe PMC) | NA | BioGRID |
| UBL4A | Affinity Capture-MS | physical | 23246001, (Europe PMC) | NA | BioGRID |
| UCHL5 | Reconstituted Complex | physical | 21800051, (Europe PMC) | NA | BioGRID |
| UNK | Affinity Capture-RNA | physical | 25737280, (Europe PMC) | NA | BioGRID |
| UPF1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical | 19417104, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VDAC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WEE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25852190, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WWP2 | Affinity Capture-MS | physical | 25071155, (Europe PMC) | NA | BioGRID |
| XPO1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| XRCC6 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| YWHAQ | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| YWHAZ | pull down | physical association | 15161933, (Europe PMC) | 0.40 | IntAct, MINT |
| ZMYM1 | anti tag coimmunoprecipitation | association | 25852190, (Europe PMC) | 0.35 | IntAct |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| CDK2 | S595_NVLCLSKsPNKHNRL, T435_RIMGPNYtPGKKEDL, | NA | NA | PhosphoSitePlus, |
| EEF2K | T54_ASARAGEtRFTDTRK, T57_RAGETRFtDTRKDEQ, T59_GETRFTDtRKDEQER, | in vitro, in vivo | 17287340, 18212344, 18669648, 18767875, 19413330, 19651622, 20068231, 20166139, 8386634, 91085562,(Europe PMC) | HPRD, |
| Unknown | S399_GPLMMYIsKMVPTSD, S48_CKAGIIAsARAGETR, S502_RVMKFSVsPVVRVAV, S623_DIDKGEVsARQELKQ, T435_RIMGPNYtPGKKEDL, T54_ASARAGEtRFTDTRK, T57_RAGETRFtDTRKDEQ, T59_GETRFTDtRKDEQER, T724_GGGQIIPtARRCLYA, Y373_KYRCELLyEGPPDDE, Y443_PGKKEDLyLKPIQRT, | HTP, LTP, in vitro, in vivo | 15302935, 15592455, 16083285, 16964243, 17081983, 17287340, 17322306, 18212344, 18669648, 18767875, 19413330, 19651622, 19664994, 20068231, 20166139, 2261989, 8386634,(Europe PMC) | HPRD, PhosphoELM, |