Top CUX1
Localization (UniProt annotation) Nucleus Function (UniProt annotation) Probably has a broad role in mammalian development as arepressor of developmentally regulated gene expression May act bypreventing binding of positively-activing CCAAT factors topromoters Component of nf-munr repressor; binds to the matrixattachment regions (MARs) (5' and 3') of the immunoglobulin heavychain enhancer Represses T-cell receptor (TCR) beta enhancerfunction by binding to MARbeta, an ATC-rich DNA sequence locatedupstream of the TCR beta enhancer Binds to the TH enhancer; mayrequire the basic helix-loop-helix protein TCF4 as a coactivator(By similarity) Catalytic Activity (UniProt annotation) N/A Protein Sequence MLCVAGARLKRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSFQGEIDALSKRSKEAEAAFLN
VYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETI
ALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERAN
QRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENS
ASQISQLEQQLSAKNSTLKQLEEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALR
ISNSDLSGSARRKGKDQPESRRPGSLPAPPPSQLPRNPGEQASNTNGTHQFSPAGLSQDFFSSSLASPSLPLASTGKFAL
NSLLQRQLMQSFYSKAMQEAGSTSMIFSTGPYSTNSISSQSPLQQSPDVNGMAPSPSQSESAGSVSEGEEMDTAEIARQV
KEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLTVRGKEPFHKMKQFLSDEQNILALRSIQGRQRENPGQSLNR
LFQEVPKRRNGSEGNITTRIRASETGSDEAIKSILEQAKRELQVQKTAEPAQPSSASGSGNSDDAIRSILQQARREMEAQ
QAALDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAA
DCAQGVLRQVKNEVGRSGAWKDHWWSAVQPERRNAASSEEAKAEETGGGKEKGSGGSGGGSQPRAERSQLQGPSSSEYWK
EWPSAESPYSQSSELSLTGASRSETPQNSPLPSSPIVPMSKPTKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNG
ICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQQQGPVLHSVTSLQDPLQQGC
VSSESTPKTSASCSPAPESPMSSSESVKSLTELVQQPCPPIEASKDSKPPEPSDPPASDSQPTTPLPLSGHSALSIQELV
AMSPELDTYGITKRVKEVLTDNNLGQRLFGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMD
MKRMEKKAYMKRRHSSVSDSQPCEPPSVGTEYSQGASPQPQHQLKKPRVVLAPEEKEALKRAYQQKPYPSPKTIEDLATQ
LNLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASDSPSARSGRAAPSSEGDSCDGVEATEGPGSADTEEPKSQGE
AEREEVPRPAEQTEPPPSGTPGPDDARDDDHEGGPVEGPGPLPSPASATATAAPAAPEDAATSAAAAPGEGPAAPSSAPP
PSNSSSSSAPRRPSSLQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF
Pathway ID Pathway Name Pathway Description (KEGG) NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1839117 Signaling by cytosolic FGFR1 fusion mutants. 8p11 myeloproliferative syndrome (EMS) is an aggressive disorder that is associated with a translocation event at the FGFR1 gene on chromosome 8p11. Typical symptoms upon diagnosis include eosinophilia and associated T-cell lymphoblastic lymphoma; the disease rapidly advances to acute leukemia, usually of myeloid lineage. At present the only effective treatment is allogenic stem cell transplantation (reviewed in Jackson, 2010). At the molecular level, EMS appears to be caused by translocation events on chromosome 8 that create gene fusions between the intracellular domain of FGFR1 and an N-terminal partner gene that encodes a dimerization domain. The resulting fusion protein dimerizes in a ligand-independent fashion based the N-terminal domain provided by the partner protein and stimulates constititutive downstream FGFR1 signaling without altering the intrisic kinase activity of the receptor. To date, 11 partner genes have been identified: ZMYM2, FGFR1OP, FGFR1OP2, HERVK, TRIM24, CUX1, BCR, CEP110, LRRFIP1, MYO18A and CPSF6, although not all have been functionally characterized (reviewed in Jackson, 2010, Turner and Grose, 2010; Wesche, 2011). Where examined, cell lines carrying FGFR1 fusion genes have been shown to be transforming and to support IL3-independent proliferation through anti-apoptotic, prosurvival pathways(Lelievre, 2008; Ollendorff, 1999; Chase, 2007; Guasch, 2001; Wasag 2011; Roumiantsev, 2004; Demiroglu, 2001; Smedley, 1999). Signaling appears to occur predominantly through PLCgamma, PI3K and STAT signaling, with a more minor contribution from MAPK activation. Because the fusion proteins lack the FRS2-binding site, the mechanism of MAPK activation is unclear. Recruitment of GRB2:SOS1 through recruitment of SHC is one possibility (Guasch, 2001) R-HSA-5655302 Signaling by FGFR1 in disease. The FGFR1 gene has been shown to be subject to activating mutations, chromosomal rearrangements and gene amplification leading to a variety of proliferative and developmental disorders depending on whether these events occur in the germline or arise somatically (reviewed in Webster and Donoghue, 1997; Burke, 1998; Cunningham, 2007; Wesche, 2011; Greulich and Pollock, 2011). Activating mutation P252R in FGFR1 is associated with the development of Pfeiffer syndrome, characterized by craniosynostosis (premature fusion of several sutures in the skull) and broadened thumbs and toes (Muenke, 1994; reviewed in Cunningham, 2007). This residue falls in a highly conserved Pro-Ser dipeptide between the second and third Ig domains of the extracellular region of the receptor. The mutation is thought to increase the number of hydrogen bonds formed with the ligand and to thereby increase ligand-binding affinity (Ibrahimi, 2004a). Unlike other FGF receptors, few activating point mutations in the FGFR1 coding sequence have been identified in cancer. Point mutations in the Ig II-III linker analagous to the P252R Pfeiffer syndrome mutation have been identified in lung cancer and melanoma (Ruhe, 2007; Davies, 2005), and two kinase-domain mutations in FGFR1 have been identified in glioblastoma (Rand, 2005, Network TCGA, 2008).In contrast, FGFR1 is a target of chromosomal rearrangements in a number of cancers. FGFR1 has been shown to be recurrently translocated in the 8p11 myeloproliferative syndrome (EMS), a pre-leukemic condition also known as stem cell leukemia/lymphoma (SCLL) that rapidly progresses to leukemia. This translocation fuses the kinase domain of FGFR1 with the dimerization domain of one of 10 identified fusion partners, resulting in the constitutive dimerization and activation of the kinase (reviewed in Jackson, 2010). Amplification of the FGFR1 gene has been implicated as a oncogenic factor in a range of cancers, including breast, ovarian, bladder, lung, oral squamous carcinomas, and rhabdomyosarcoma (reviewed in Turner and Grose, 2010; Wesche, 2011; Greulich and Pollock, 2011), although there are other candidate genes in the amplified region and the definitive role of FGFR1 has not been fully established.More recently, FGFR1 fusion proteins have been identified in a number of cancers; these are thought to undergo constitutive ligand-independent dimerization and activation based on dimerization motifs found in the fusion partners (reviewed in Parker, 2014)
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CCNA1 Reconstituted Complex physical 11584018 , (Europe PMC )NA BioGRID CDK1 Biochemical Activity physical 11584018 , (Europe PMC )NA BioGRID CDK7 Reconstituted Complex physical 11584018 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Reconstituted Complex physical 10852958 , (Europe PMC )NA BioGRID ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EHMT2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex physical 15269344 , (Europe PMC )NA BioGRID ELAC2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EXT2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FOXD3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXG1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXJ2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXK2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXN1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXO1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT GABRE Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID GAN Affinity Capture-MS physical 26460568 , (Europe PMC )NA BioGRID HLA-DQA1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID KAT2B Biochemical Activity physical 10852958 , (Europe PMC )NA BioGRID KCND3 Affinity Capture-Western physical 17725712 , (Europe PMC )NA BioGRID LAMP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAGEA10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAX Two-hybrid physical 20936779 , (Europe PMC )NA BioGRID NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NIT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID POTEB3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTH1R Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RAB30 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, imaging technique, pull down, two hybrid colocalization, direct interaction, physical, physical association 12891711 , (Europe PMC )0.61 BioGRID, IntAct, MINT RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT RECQL5 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct SATB1 Affinity Capture-Western, Reconstituted Complex physical 10373541 , (Europe PMC )NA BioGRID SLC39A12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC39A4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SOX2 Affinity Capture-MS physical 21532573 , 23667531 , (Europe PMC )NA BioGRID SPATS2L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STX6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SUMO2 Reconstituted Complex physical 19394292 , (Europe PMC )NA BioGRID TACC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TLE4 Affinity Capture-Western, Reconstituted Complex physical 19332113 , (Europe PMC )NA BioGRID TP53BP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID WDR83 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CA12 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct ELAC2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct FOXD3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXG1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXJ2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXK2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXN1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXO1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT HIST1H3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ILKAP pull down association 28330616 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAX two hybrid pooling approach physical association 20936779 , (Europe PMC )0.37 IntAct NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, imaging technique, pull down, two hybrid colocalization, direct interaction, physical, physical association 12891711 , (Europe PMC )0.61 BioGRID, IntAct, MINT RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT RECQL5 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct SPATS2L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TACC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXG1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXJ2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXK2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXN1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXO1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, imaging technique, pull down, two hybrid colocalization, direct interaction, physical, physical association 12891711 , (Europe PMC )0.61 BioGRID, IntAct, MINT RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CA12 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct CCNA1 Reconstituted Complex physical 11584018 , (Europe PMC )NA BioGRID CDK1 Biochemical Activity physical 11584018 , (Europe PMC )NA BioGRID CDK7 Reconstituted Complex physical 11584018 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-Western, Reconstituted Complex physical 10852958 , (Europe PMC )NA BioGRID ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EHMT2 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex physical 15269344 , (Europe PMC )NA BioGRID ELAC2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EXT2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FOXD3 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXE1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXG1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXJ2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXK2 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXN1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXO1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXP1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT FOXQ1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT GABRE Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID GAN Affinity Capture-MS physical 26460568 , (Europe PMC )NA BioGRID HIST1H3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HLA-DQA1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID ILKAP pull down association 28330616 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KAT2B Biochemical Activity physical 10852958 , (Europe PMC )NA BioGRID KCND3 Affinity Capture-Western physical 17725712 , (Europe PMC )NA BioGRID LAMP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAGEA10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAX Two-hybrid physical 20936779 , (Europe PMC )NA BioGRID MAX two hybrid pooling approach physical association 20936779 , (Europe PMC )0.37 IntAct NFATC1 Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT NIT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID POTEB3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTH1R Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RAB30 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, imaging technique, pull down, two hybrid colocalization, direct interaction, physical, physical association 12891711 , (Europe PMC )0.61 BioGRID, IntAct, MINT RBPJ Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT RECQL5 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct SATB1 Affinity Capture-Western, Reconstituted Complex physical 10373541 , (Europe PMC )NA BioGRID SLC39A12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC39A4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SOX2 Affinity Capture-MS physical 21532573 , 23667531 , (Europe PMC )NA BioGRID SPATS2L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STX6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SUMO2 Reconstituted Complex physical 19394292 , (Europe PMC )NA BioGRID TACC3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TLE4 Affinity Capture-Western, Reconstituted Complex physical 19332113 , (Europe PMC )NA BioGRID TP53BP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID WDR83 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ATR S1357_ADTEEPKsQGEAERE , NA NA PhosphoSitePlus , CDK1 S1237_TEYSQGAsPQPQHQL , S1270_YQQKPYPsPKTIEDL , LTP, in vitro 11584018 ,(Europe PMC )HPRD, PhosphoELM , PKA_group S1215_AYMKRRHsSVSDSQP , LTP 16574653 ,(Europe PMC )PhosphoELM , PRKACA S1215_AYMKRRHsSVSDSQP , S1237_TEYSQGAsPQPQHQL , S1270_YQQKPYPsPKTIEDL , NA NA PhosphoSitePlus , Unknown S1054_PKTSASCsPAPESPM , S1059_SCSPAPEsPMSSSES , S1218_KRRHSSVsDSQPCEP , S1233_PSVGTEYsQGASPQP , S1312_IEEIQAGsQGQAGAS , S1357_ADTEEPKsQGEAERE , S1454_SSAPRRPsSLQSLFG , S1496_HRLEKAAsREEPIEW , S322_KLRENSAsQISQLEQ , S331_ISQLEQQsSAKNSTL , S333_QLEQQLSsKNSTLKQ , S391_LLLEKNRsLQSENAA , S400_QSENAALsISNSDLS , S402_ENAALRIsNSDLSGS , S409_SNSDLSGsARRKGKD , S452_TNGTHQFsPAGLSQD , S467_FFSSSLAsPSLPLAS , S663_ITTRIRAsETGSDEA , S667_IRASETGsDEAIKSI , S734_ALKQAPLsQSDITIL , S749_TPKLLSTsPMPTVSS , S763_SYPPLAIsLKKPSAA , S974_GEKVLGLsQGSVSDM , T1071_SESVKSLtELVQQPC , T665_TRIRASEtGSDEAIK , Y1232_PPSVGTEySQGASPQ , HTP, in vivo 17525332 , 18077418 , 18212344 , 18669648 , 19413330 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
