- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
CFL1
Gene Name  | CFL1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 1Q8X |
| Synonyms | CFL1, CFL | |
| Protein Name | CFL1 | |
| Alternative Name(s) | Cofilin-1;18 kDa phosphoprotein;p18;Cofilin, non-muscle isoform; | |
| Protein Family | Belongs to the actin-binding proteins ADF family | |
| EntrezGene ID | 1072 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P23528 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 18502 Dalton | |
| Protein Length | 166 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000172757 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG1735 | eggNOG - ENOG41122P5 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam)  | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Nucleus matrix Cytoplasm, cytoskeleton Cell projection, ruffle membrane Cell projection, lamellipodiummembrane Cell projection, lamellipodium Note=Colocalizes with the actincytoskeleton in membrane ruffles and lamellipodia Detected at thecleavage furrow and contractile ring during cytokinesis Almostcompletely in nucleus in cells exposed to heat shock or 10%dimethyl sulfoxide | |||
| Function (UniProt annotation) | |||
| Binds to F-actin and exhibits pH-sensitive F-actindepolymerizing activity Regulates actin cytoskeleton dynamicsImportant for normal progress through mitosis and normalcytokinesis Plays a role in the regulation of cell morphology andcytoskeletal organization Required for the up-regulation ofatypical chemokine receptor ACKR2 from endosomal compartment tocell membrane, increasing its efficiency in chemokine uptake anddegradation (PubMed:11812157, PubMed:15580268, PubMed:21834987,PubMed:23633677) Required for neural tube morphogenesis andneural crest cell migration (By similarity) | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVIS LEGKPL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance
| Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000281 | P:mitotic cytokinesis |
| GO:0001755 | P:neural crest cell migration |
| GO:0001842 | P:neural fold formation |
| GO:0005102 | F:signaling receptor binding |
| GO:0005615 | C:extracellular space |
| GO:0005634 | C:nucleus |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005911 | C:cell-cell junction |
| GO:0005925 | C:focal adhesion |
| GO:0006468 | P:protein phosphorylation |
| GO:0007010 | P:cytoskeleton organization |
| GO:0007266 | P:Rho protein signal transduction |
| GO:0009615 | P:response to virus |
| GO:0016020 | C:membrane |
| GO:0016363 | C:nuclear matrix |
| GO:0022604 | P:regulation of cell morphogenesis |
| GO:0030010 | P:establishment of cell polarity |
| GO:0030027 | C:lamellipodium |
| GO:0030036 | P:actin cytoskeleton organization |
| GO:0030042 | P:actin filament depolymerization |
| GO:0030043 | P:actin filament fragmentation |
| GO:0030836 | P:positive regulation of actin filament depolymerization |
| GO:0030864 | C:cortical actin cytoskeleton |
| GO:0031258 | C:lamellipodium membrane |
| GO:0031982 | C:vesicle |
| GO:0032587 | C:ruffle membrane |
| GO:0035722 | P:interleukin-12-mediated signaling pathway |
| GO:0043066 | P:negative regulation of apoptotic process |
| GO:0043200 | P:response to amino acid |
| GO:0044794 | P:positive regulation by host of viral process |
| GO:0051015 | F:actin filament binding |
| GO:0061001 | P:regulation of dendritic spine morphogenesis |
| GO:0070062 | C:extracellular exosome |
CFL1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in CFL1 (P23528) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PDXP | Q96GD0 | Ser-3_---MAsGVMVS, | In vitro and in vivo | 15580268, | Europe PMC |  |
| SSH1 | Q8WYL5 | Ser-3_---MAsGVAVS, | In vitro and in vivo | 11832213, 14531860, | Europe PMC | |
| SSH2 | Q76I76 | Ser-3_---MAsGVAVS, | In vitro and in vivo | 11832213, 14531860, | Europe PMC | |
| SSH3 | Q8TE77 | Ser-3_---MAsGVAVS, | In vitro and in vivo | 14531860, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04360 | Axon guidance | Axon guidance represents a key stage in the formation of neuronal network. Axons are guided by a variety of guidance factors, such as netrins, ephrins, Slits, and semaphorins. These guidance cues are read by growth cone receptors, and signal transduction pathways downstream of these receptors converge onto the Rho GTPases to elicit changes in cytoskeletal organization that determine which way the growth cone will turn. |
| hsa04666 | Fc gamma R-mediated phagocytosis | Phagocytosis plays an essential role in host-defense mechanisms through the uptake and destruction of infectious pathogens. Specialized cell types including macrophages, neutrophils, and monocytes take part in this process in higher organisms. After opsonization with antibodies (IgG), foreign extracellular materials are recognized by Fc gamma receptors. Cross-linking of Fc gamma receptors initiates a variety of signals mediated by tyrosine phosphorylation of multiple proteins, which lead through the actin cytoskeleton rearrangements and membrane remodeling to the formation of phagosomes. Nascent phagosomes undergo a process of maturation that involves fusion with lysosomes. The acquisition of lysosomal proteases and release of reactive oxygen species are crucial for digestion of engulfed materials in phagosomes. |
| hsa04810 | Regulation of actin cytoskeleton | |
| hsa05133 | Pertussis | Pertussis, also known as whooping cough, is an acute respiratory infectious disease caused by a bacteria called Bordetella Pertussis. The characteristic symptoms are paroxysmal cough, inspiratory wheezing and post-tussive vomiting.Following the inhalation of respiratory secretions from an infected individual, bacteria enter the upper respiratory tract and adhere to epithelial cells. Several adhesion factors have been implicated: the filamentous hemagglutinin (FHA), fimbriae, and pertactin (Prn).Pertussis toxin (Ptx) and adenylate cyclase toxin (ACT) have been identified so far as major protein toxins of B. pertussis. PTX is a hexameric AB5-type exotoxin. Catalytic A subunit catalyzes the ADP-ribosylation of the Gi subunits of the heterotrimeric G protein, then inhibits multiple downstream pathways. ACT is able to penetrate the cytoplasmic membrane of host cells and becomes activated through the cleavage and the binding of calmodulin (CaM). Activated ACT converts ATP to cyclic AMP and subverts cellular signaling pathways. |
| hsa05170 | Human immunodeficiency virus 1 infection | Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-114608 | Platelet degranulation. | Platelets function as exocytotic cells, secreting a plethora of effector molecules at sites of vascular injury. Platelets contain a number of distinguishable storage granules including alpha granules, dense granules and lysosomes. On activation platelets release a variety of proteins, largely from storage granules but also as the result of apparent cell lysis. These act in an autocrine or paracrine fashion to modulate cell signaling. Alpha granules contain mainly polypeptides such as fibrinogen, von Willebrand factor, growth factors and protease inhibitors that that supplement thrombin generation at the site of injury. Dense granules contain small molecules, particularly adenosine diphosphate (ADP), adenosine triphosphate (ATP), serotonin and calcium, all recruit platelets to the site of injury. \n\nThe molecular mechanism which facilitates granule release involves soluble NSF attachment protein receptors (SNAREs), which assemble into complexes to form a universal membrane fusion apparatus. Although all cells use SNAREs for membrane fusion, different cells possess different SNARE isoforms. Platelets and chromaffin cells use many of the same chaperone proteins to regulate SNARE-mediated secretion (Fitch-Tewfik & Flaumenhaft 2013) |
| R-HSA-2029482 | Regulation of actin dynamics for phagocytic cup formation. | The actin cytoskeleton is fundamental for phagocytosis and members of the Rho family GTPases RAC and CDC42 are involved in actin cytoskeletal regulation leading to pseudopod extension. Active RAC and CDC42 exert their action through the members of WASP family proteins (WASP/N-WASP/WAVE) and ARP2/3 complex. Actin filaments move from the bottom toward the top of the phagocytic cup during pseudopod extension |
| R-HSA-3928662 | EPHB-mediated forward signaling. | Multiple EPHB receptors contribute directly to dendritic spine development and morphogenesis. These are more broadly involved in post-synaptic development through activation of focal adhesion kinase (FAK) and Rho family GTPases and their GEFs. Dendritic spine morphogenesis is a vital part of the process of synapse formation and maturation during CNS development. Dendritic spine morphogenesis is characterized by filopodia shortening followed by the formation of mature mushroom-shaped spines (Moeller et al. 2006). EPHBs control neuronal morphology and motility by modulation of the actin cytoskeleton. EPHBs control dendritic filopodia motility, enabling synapse formation. EPHBs exert these effects through interacting with the guanine exchange factors (GEFs) such as intersectin and kalirin. The intersectin-CDC42-WASP-actin and kalirin-RAC-PAK-actin pathways have been proposed to regulate the EPHB receptor mediated morphogenesis and maturation of dendritic spines in cultured hippocampal and cortical neurons (Irie & Yamaguchi 2002, Penzes et al. 2003). EPHBs are also involved in the regulation of dendritic spine morphology through FAK which activates the RHOA-ROCK-LIMK-1 pathway to suppress cofilin activity and inhibit cofilin-mediated dendritic spine remodeling (Shi et al. 2009) |
| R-HSA-399954 | Sema3A PAK dependent Axon repulsion. | Activated Rac1 bound to plexin-A might modulate actin dynamics through the sequential phosphorylation and activation of PAK, LIMK1 and cofilin |
| R-HSA-5627117 | RHO GTPases Activate ROCKs. | RHO associated, coiled-coil containing protein kinases ROCK1 and ROCK2 consist of a serine/threonine kinase domain, a coiled-coil region, a RHO-binding domain and a plekstrin homology (PH) domain interspersed with a cysteine-rich region. The PH domain inhibits the kinase activity of ROCKs by an intramolecular fold. ROCKs are activated by binding of the GTP-bound RHO GTPases RHOA, RHOB and RHOC to the RHO binding domain of ROCKs (Ishizaki et al. 1996, Leung et al. 1996), which disrupts the autoinhibitory fold. Once activated, ROCK1 and ROCK2 phosphorylate target proteins, many of which are involved in the stabilization of actin filaments and generation of actin-myosin contractile force. ROCKs phosphorylate LIM kinases LIMK1 and LIMK2, enabling LIMKs to phosphorylate cofilin, an actin depolymerizing factor, and thereby regulate the reorganization of the actin cytoskeleton (Ohashi et al. 2000, Sumi et al. 2001). ROCKs phosphorylate MRLC (myosin regulatory light chain), which stimulates the activity of non-muscle myosin II (NMM2), an actin-based motor protein involved in cell migration, polarity formation and cytokinesis (Amano et al. 1996, Riento and Ridley 2003, Watanabe et al. 2007, Amano et al. 2010). ROCKs also phosphorylate the myosin phosphatase targeting subunit (MYPT1) of MLC phosphatase, inhibiting the phosphatase activity and preventing dephosphorylation of MRLC. This pathway acts synergistically with phosphorylation of MRLC by ROCKs towards stimulation of non-muscle myosin II activity (Kimura et al. 1996, Amano et al. 2010) |
| R-HSA-8950505 | Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation. | Experiments using human cord blood CD4(+) T cells show 22 protein spots and 20 protein spots, upregulated and downregulated proteins respectively, following Interleukin-12 stimulation (Rosengren et.al, 2005).\n The identified upregulated proteins are: BOLA2, PSME2, MTAP, CA1, GSTA2, RALA, CNN2, CFL1, TCP1, HNRNPDL, MIF, AIP, SOD1, PPIA and PDCD4.And the identified downregulated proteins are:ANXA2, RPLP0, CAPZA1, SOD2, SNRPA1, LMNB1, LCP1, HSPA9, SERPINB2, HNRNPF, TALDO1, PAK2, TCP1, HNRNPA2B1, MSN, PITPNA, ARF1, SOD2, ANXA2, CDC42, RAP1B and GSTO1 |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACAA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ACTA1 | Affinity Capture-MS, Reconstituted Complex | physical | 11950878, 21723825, (Europe PMC) | NA | BioGRID |
| ACTB | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| ACTBL2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ACTG1 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| ACTR2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKR1A1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ALDH4A1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ALDOA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANLN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APP | Two-hybrid | physical | 21163940, (Europe PMC) | NA | BioGRID |
| ARF4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARRB1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 17500066, 17620599, (Europe PMC) | 0.58 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 17500066, 17620599, (Europe PMC) | 0.58 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATXN1 | Affinity Capture-Western, Two-hybrid, pull down, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CAP1 | Affinity Capture-MS | physical | 11950878, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CAP2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CAPG | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CAPZA2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CD81 | Affinity Capture-MS | physical | 23463506, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CFL2 | Two-hybrid, two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CFTR | Affinity Capture-MS | physical | 17110338, (Europe PMC) | NA | BioGRID |
| CKS2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| COTL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| COX17 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CRIP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CSRP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAZAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBNL | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DCAF4L2 | Affinity Capture-MS | physical | 27158335, (Europe PMC) | NA | BioGRID |
| DUT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DYNLL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ECT2 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| EED | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 20029029, 24658140, (Europe PMC) | 0.55 | BioGRID, IntAct |
| EIF4B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ENO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ESR1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FAHD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FLNA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FUS | Affinity Capture-MS | physical | 25192599, (Europe PMC) | NA | BioGRID |
| G3BP1 | Affinity Capture-MS | physical | 26777405, (Europe PMC) | NA | BioGRID |
| GAPDH | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GPT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GPT2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| H2AFX | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 20000738, (Europe PMC) | 0.43 | BioGRID, IntAct |
| HECW2 | Affinity Capture-MS | physical | 24163370, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HSPA9 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPE1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPH1 | Reconstituted Complex, Two-hybrid | physical | 14733918, (Europe PMC) | NA | BioGRID |
| IGSF8 | Affinity Capture-MS | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS, Affinity Capture-Western | physical | 16009940, 16815975, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| JPT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KYNU | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LDHA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LDHAL6A | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LDHB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LIMA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LIMK1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 10436159, 12963706, 15220930, 16278681, 17500066, 17853892, 19424295, 20133759, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| LIMK2 | Affinity Capture-Western | physical | 10436159, (Europe PMC) | NA | BioGRID |
| LYPLA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAPK8IP2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MDH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MTAP | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MYCBP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYH9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO18A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO19 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MYO1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NME1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NME1-NME2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NME2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUP214 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PCBP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PEBP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PFN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PIN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PIR | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PKM | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| POLR1C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| POT1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPIA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PPP1CB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDX1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRDX5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRKCZ | Affinity Capture-Western | physical | 23402259, (Europe PMC) | NA | BioGRID |
| PSEN1 | Two-hybrid, two hybrid | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTEN | Reconstituted Complex | physical | 26561776, (Europe PMC) | NA | BioGRID |
| PTGR1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PUDP | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RAB10 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RAB7A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAD21 | Two-hybrid | physical | 22145905, (Europe PMC) | NA | BioGRID |
| ROCK1 | Affinity Capture-Western | physical | 10436159, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RTN4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SERPINH1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SOD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SRC | Biochemical Activity | physical | 19802004, (Europe PMC) | NA | BioGRID |
| SRXN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| STYX | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SUGT1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TAB1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TAGLN | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TAGLN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TANGO2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TERF1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| TKT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPI1 | Affinity Capture-Western | physical | 12359716, (Europe PMC) | NA | BioGRID |
| TRAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TRIM15 | PCA | physical | 25450970, (Europe PMC) | NA | BioGRID |
| TXNDC17 | Affinity Capture-MS | physical | 14607843, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, (Europe PMC) | NA | BioGRID |
| UBA52 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UCHL5 | Reconstituted Complex | physical | 21800051, (Europe PMC) | NA | BioGRID |
| UFD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UFM1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDR1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| WWP2 | Affinity Capture-MS | physical | 25071155, (Europe PMC) | NA | BioGRID |
| YWHAQ | Reconstituted Complex | physical | 15161933, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTG1 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| ACTR2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ANLN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARRB1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 17500066, 17620599, (Europe PMC) | 0.58 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 17500066, 17620599, (Europe PMC) | 0.58 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATXN1 | Affinity Capture-Western, Two-hybrid, pull down, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CAPZA2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CFL2 | Two-hybrid, two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EBI-1059270 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 20029029, 24658140, (Europe PMC) | 0.55 | BioGRID, IntAct |
| ERBB4 | ubiquitin reconstruction | physical association | 24658140, (Europe PMC) | 0.37 | IntAct |
| ESR1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FLNA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| H2AFX | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 20000738, (Europe PMC) | 0.43 | BioGRID, IntAct |
| HUNK | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical association | 20133759, (Europe PMC) | 0.52 | IntAct |
| IQGAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LIMA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LIMK1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 10436159, 12963706, 15220930, 16278681, 17500066, 17853892, 19424295, 20133759, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAPK8IP2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MYC | tandem affinity purification | association | 21150319, (Europe PMC) | 0.35 | IntAct |
| MYCBP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYH9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO18A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO19 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MYO1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFKB1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLD1 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, direct interaction, physical association | 17853892, (Europe PMC) | 0.57 | IntAct, MINT |
| PLD2 | anti bait coimmunoprecipitation, pull down | direct interaction, physical association | 17853892, (Europe PMC) | 0.54 | IntAct, MINT |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| POT1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPP1CB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2CA | anti bait coimmunoprecipitation | physical association | 20133759, (Europe PMC) | 0.40 | IntAct |
| PSEN1 | Two-hybrid, two hybrid | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| RAB7A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SSH1 | pull down | physical association | 21525957, (Europe PMC) | 0.40 | IntAct, MINT |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TAB1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TAGLN | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TERF1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAG | pull down | association, physical association | 15598710, (Europe PMC) | 0.50 | IntAct, MINT |
| YWHAZ | affinity chromatography technology, pull down | physical association | 12361576, 15161933, (Europe PMC) | 0.66 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ESR1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| LIMK1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 10436159, 12963706, 15220930, 16278681, 17500066, 17853892, 19424295, 20133759, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAPK8IP2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NFKB1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PLD1 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, direct interaction, physical association | 17853892, (Europe PMC) | 0.57 | IntAct, MINT |
| PLD2 | anti bait coimmunoprecipitation, pull down | direct interaction, physical association | 17853892, (Europe PMC) | 0.54 | IntAct, MINT |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SSH1 | pull down | physical association | 21525957, (Europe PMC) | 0.40 | IntAct, MINT |
| TAB1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| YWHAG | pull down | association, physical association | 15598710, (Europe PMC) | 0.50 | IntAct, MINT |
| YWHAZ | affinity chromatography technology, pull down | physical association | 12361576, 15161933, (Europe PMC) | 0.66 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACAA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ACTA1 | Affinity Capture-MS, Reconstituted Complex | physical | 11950878, 21723825, (Europe PMC) | NA | BioGRID |
| ACTB | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| ACTBL2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| ACTG1 | Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 16189514, 25416956, (Europe PMC) | 0.76 | BioGRID, IntAct |
| ACTR2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AKR1A1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ALDH4A1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ALDOA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ANLN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APP | Two-hybrid | physical | 21163940, (Europe PMC) | NA | BioGRID |
| ARF4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ARRB1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 17500066, 17620599, (Europe PMC) | 0.58 | BioGRID, IntAct |
| ARRB2 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 17500066, 17620599, (Europe PMC) | 0.58 | BioGRID, IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATXN1 | Affinity Capture-Western, Two-hybrid, pull down, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.51 | BioGRID, IntAct |
| CAP1 | Affinity Capture-MS | physical | 11950878, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CAP2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| CAPG | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CAPZA2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CD81 | Affinity Capture-MS | physical | 23463506, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CFL2 | Two-hybrid, two hybrid | physical, physical association | 21516116, 25416956, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CFTR | Affinity Capture-MS | physical | 17110338, (Europe PMC) | NA | BioGRID |
| CKS2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| COTL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| COX17 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CRIP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CSRP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYLD | Affinity Capture-MS | physical | 27591049, (Europe PMC) | NA | BioGRID |
| DAZAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBNL | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DCAF4L2 | Affinity Capture-MS | physical | 27158335, (Europe PMC) | NA | BioGRID |
| DUT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DYNLL1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EBI-1059270 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| ECT2 | Affinity Capture-MS | physical | 22990118, (Europe PMC) | NA | BioGRID |
| EED | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| EGFR | PCA, ubiquitin reconstruction | physical, physical association | 20029029, 24658140, (Europe PMC) | 0.55 | BioGRID, IntAct |
| EIF4B | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EIF6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ENO1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ERBB4 | ubiquitin reconstruction | physical association | 24658140, (Europe PMC) | 0.37 | IntAct |
| ESR1 | Two-hybrid, two hybrid array | physical, physical association | 25640309, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| FAHD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| FBXO25 | Affinity Capture-MS | physical | 20473970, (Europe PMC) | NA | BioGRID |
| FLNA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FN1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FUS | Affinity Capture-MS | physical | 25192599, (Europe PMC) | NA | BioGRID |
| G3BP1 | Affinity Capture-MS | physical | 26777405, (Europe PMC) | NA | BioGRID |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GAPDH | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GPT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GPT2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| GRK5 | Affinity Capture-MS | physical | 22952844, (Europe PMC) | NA | BioGRID |
| H2AFX | Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, confocal microscopy | association, colocalization, physical | 20000738, (Europe PMC) | 0.43 | BioGRID, IntAct |
| HECW2 | Affinity Capture-MS | physical | 24163370, (Europe PMC) | NA | BioGRID |
| HNRNPA1 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| HSPA9 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPE1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| HSPH1 | Reconstituted Complex, Two-hybrid | physical | 14733918, (Europe PMC) | NA | BioGRID |
| HUNK | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | physical association | 20133759, (Europe PMC) | 0.52 | IntAct |
| IGSF8 | Affinity Capture-MS | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS, Affinity Capture-Western | physical | 16009940, 16815975, (Europe PMC) | NA | BioGRID |
| ITGA4 | Affinity Capture-MS | physical | 22623428, (Europe PMC) | NA | BioGRID |
| JPT1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KYNU | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LDHA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LDHAL6A | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LDHB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| LIMA1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LIMK1 | Biochemical Activity, anti bait coimmunoprecipitation, protein kinase assay | phosphorylation reaction, physical, physical association | 10436159, 12963706, 15220930, 16278681, 17500066, 17853892, 19424295, 20133759, (Europe PMC) | 0.72 | BioGRID, IntAct, MINT |
| LIMK2 | Affinity Capture-Western | physical | 10436159, (Europe PMC) | NA | BioGRID |
| LYPLA2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MAP1LC3A | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| MAPK6 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MAPK8IP2 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MDH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MTAP | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| MYC | tandem affinity purification | association | 21150319, (Europe PMC) | 0.35 | IntAct |
| MYCBP | Two-hybrid, two hybrid pooling approach | physical, physical association | 16169070, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYH9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO18A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO19 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MYO19 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MYO1C | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NFKB1 | tandem affinity purification | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| NME1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NME1-NME2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NME2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| NPM1 | Affinity Capture-MS | physical | 23402259, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUP214 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| OCRL | anti tag coimmunoprecipitation | association | 25107275, (Europe PMC) | 0.35 | IntAct, MINT |
| PAN2 | Affinity Capture-MS | physical | 23398456, (Europe PMC) | NA | BioGRID |
| PCBP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PEBP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PFN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PIN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PIR | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PKM | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PLD1 | anti bait coimmunoprecipitation, fluorescence microscopy, pull down | colocalization, direct interaction, physical association | 17853892, (Europe PMC) | 0.57 | IntAct, MINT |
| PLD2 | anti bait coimmunoprecipitation, pull down | direct interaction, physical association | 17853892, (Europe PMC) | 0.54 | IntAct, MINT |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| POLR1C | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| POT1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PPIA | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PPP1CB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2CA | anti bait coimmunoprecipitation | physical association | 20133759, (Europe PMC) | 0.40 | IntAct |
| PRDX1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRDX5 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PRKCZ | Affinity Capture-Western | physical | 23402259, (Europe PMC) | NA | BioGRID |
| PSEN1 | Two-hybrid, two hybrid | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTBP3 | anti bait coimmunoprecipitation | association | 22575643, (Europe PMC) | 0.35 | IntAct, MINT |
| PTEN | Reconstituted Complex | physical | 26561776, (Europe PMC) | NA | BioGRID |
| PTGR1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| PUDP | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RAB10 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| RAB7A | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RAD21 | Two-hybrid | physical | 22145905, (Europe PMC) | NA | BioGRID |
| ROCK1 | Affinity Capture-Western | physical | 10436159, (Europe PMC) | NA | BioGRID |
| RPS6KA1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RPS6KB2 | Affinity Capture-MS | physical | 25324306, (Europe PMC) | NA | BioGRID |
| RTN4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SERPINH1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SMURF1 | Affinity Capture-MS | physical | 23184937, (Europe PMC) | NA | BioGRID |
| SOD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SRC | Biochemical Activity | physical | 19802004, (Europe PMC) | NA | BioGRID |
| SRXN1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| SSH1 | pull down | physical association | 21525957, (Europe PMC) | 0.40 | IntAct, MINT |
| STYX | Affinity Capture-MS | physical | 27432908, (Europe PMC) | NA | BioGRID |
| SUGT1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TAB1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TAGLN | Affinity Capture-MS, anti bait coimmunoprecipitation | physical, physical association | 17353931, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TAGLN2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TANGO2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TERF1 | Two-hybrid, bimolecular fluorescence complementation | physical, physical association | 21044950, (Europe PMC) | 0.37 | BioGRID, IntAct |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| TKT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPI1 | Affinity Capture-Western | physical | 12359716, (Europe PMC) | NA | BioGRID |
| TRAP1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TRIM15 | PCA | physical | 25450970, (Europe PMC) | NA | BioGRID |
| TXNDC17 | Affinity Capture-MS | physical | 14607843, (Europe PMC) | NA | BioGRID |
| U2AF2 | Affinity Capture-MS | physical | 26641092, (Europe PMC) | NA | BioGRID |
| UBA52 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| UCHL5 | Reconstituted Complex | physical | 21800051, (Europe PMC) | NA | BioGRID |
| UFD1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| UFM1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| VCAM1 | Affinity Capture-MS, cross-linking study | association, physical | 19738201, 22623428, (Europe PMC) | 0.35 | BioGRID, IntAct |
| WDR1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| WWP2 | Affinity Capture-MS | physical | 25071155, (Europe PMC) | NA | BioGRID |
| YWHAG | pull down | association, physical association | 15598710, (Europe PMC) | 0.50 | IntAct, MINT |
| YWHAQ | Reconstituted Complex | physical | 15161933, (Europe PMC) | NA | BioGRID |
| YWHAZ | affinity chromatography technology, pull down | physical association | 12361576, 15161933, (Europe PMC) | 0.66 | IntAct, MINT |