Top
PPM1G
Localization (UniProt annotation) Cytoplasm Membrane Function (UniProt annotation) NA Catalytic Activity (UniProt annotation) [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate Protein Sequence MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIK
DQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNEEAALLHEEATMTIEELLTRY
GQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAGQVGEPGIPTGEAGPS
CSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEEEDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGK
EEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAI
GDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELL
DQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of PPM1G-substrates in Humans Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AHCYL1 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID AHSA1 Affinity Capture-Western physical 22504172 , (Europe PMC )NA BioGRID APEH Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID BAP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID BTRC Proximity Label-MS physical 25900982 , (Europe PMC )NA BioGRID CAND1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CERKL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID COPA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID COPB2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID COPE Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CPA6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EWSR1 Proximity Label-MS physical 24999758 , (Europe PMC )NA BioGRID FAF1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FBXL17 Affinity Capture-MS physical 27234298 , (Europe PMC )NA BioGRID FBXO38 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GMPS Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID H2AFX Affinity Capture-MS, Affinity Capture-Western physical 18406329 , 28514442 , (Europe PMC )NA BioGRID H2AFY2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HIRIP3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HIST1H2BA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HIST1H2BB Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HIST1H2BD Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HIST1H4A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HIST3H3 Protein-peptide physical 23281010 , (Europe PMC )NA BioGRID HSPA4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HSPH1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID IPO7 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IPO8 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IRF5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct JMJD6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID KYNU Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID LMNA Proximity Label-MS physical 22412018 , (Europe PMC )NA BioGRID LRIF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAPK11 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MAPK14 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MED4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MSL1 Two-hybrid physical 19650074 , (Europe PMC )NA BioGRID MTNR1B Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct NCBP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NEPRO Affinity Capture-MS physical 26472760 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OAS3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct PAIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PARP1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PAWR Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PFDN4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PKN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID POP1 Affinity Capture-MS physical 24778252 , (Europe PMC )NA BioGRID PPAN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PSMA1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PTK7 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PUF60 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PUS1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RBM4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RBM45 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RCC1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID S100P Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SBK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SHMT2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SNX12 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SNX3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SPHK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25216046 , 26186194 , (Europe PMC )0.35 BioGRID, IntAct SPR Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRPK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SRPK2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SRXN1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAM Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAT6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STMN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STMN2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SULT1A1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TCEANC2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TERF1 Two-hybrid, bimolecular fluorescence complementation, pull down physical, physical association 21044950 , (Europe PMC )0.51 BioGRID, IntAct TERF2 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TERF2IP Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TFEB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct THOP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TLE3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TNS2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TPD52L2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TROVE2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TTC1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TTC9C Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UBE2C Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UGP2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID USP36 Affinity Capture-MS physical 19615732 , (Europe PMC )NA BioGRID USP49 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct USP7 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 19615732 , 22361354 , 27880917 , (Europe PMC )0.40 BioGRID, IntAct VPS29 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-MS, Affinity Capture-Western physical 25071155 , (Europe PMC )NA BioGRID XPO7 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YEATS4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZNF223 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF263 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CDC25A pull down association 28330616 , (Europe PMC )0.35 IntAct CDK7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDK8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CHEK2 tandem affinity purification association 23178491 , (Europe PMC )0.35 IntAct DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct FBXO38 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GRWD1 pull down association 28330616 , (Europe PMC )0.35 IntAct HADHA pull down association 28330616 , (Europe PMC )0.35 IntAct HIF1AN anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HIST1H2AB proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H2AH proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H2BJ proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H2BK proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HIST2H2AB proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST2H2AC pull down association 28330616 , (Europe PMC )0.35 IntAct HTR2C pull down association 28330616 , (Europe PMC )0.35 IntAct IFI16 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct ILKAP pull down association 28330616 , (Europe PMC )0.35 IntAct IRF5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct ITGA9 proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KPNB1 pull down association 28330616 , (Europe PMC )0.35 IntAct LARP7 pull down association 28330616 , (Europe PMC )0.35 IntAct LRIF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LRPAP1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct MAP1S pull down association 28330616 , (Europe PMC )0.35 IntAct MTNR1B Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct NSUN2 pull down association 28330616 , (Europe PMC )0.35 IntAct OAS3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PSMC4 pull down association 28330616 , (Europe PMC )0.35 IntAct PSMD2 pull down association 28330616 , (Europe PMC )0.35 IntAct PYHIN1 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct RBM4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RBM45 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RPS3A far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SLX4 anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SNRNP70 far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct SNRPA far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct SPHK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25216046 , 26186194 , (Europe PMC )0.35 BioGRID, IntAct TERF1 Two-hybrid, bimolecular fluorescence complementation, pull down physical, physical association 21044950 , (Europe PMC )0.51 BioGRID, IntAct TERF2 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TERF2IP Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TFAM pull down association 28330616 , (Europe PMC )0.35 IntAct TFEB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TP53 anti tag coimmunoprecipitation association 22653443 , (Europe PMC )0.35 IntAct, MINT TP53BP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TRAF6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct USP36 anti tag coimmunoprecipitation physical association 19615732 , (Europe PMC )0.40 IntAct USP49 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct USP7 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 19615732 , 22361354 , 27880917 , (Europe PMC )0.40 BioGRID, IntAct VPS52 pull down association 28330616 , (Europe PMC )0.35 IntAct XRCC5 anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical association 28330616 , (Europe PMC )0.56 IntAct XRCC6 anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical association 28330616 , (Europe PMC )0.56 IntAct YBX1 far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct YEATS4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AHCYL1 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID AHSA1 Affinity Capture-Western physical 22504172 , (Europe PMC )NA BioGRID APEH Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID BAP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BTRC Proximity Label-MS physical 25900982 , (Europe PMC )NA BioGRID CAND1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CDC25A pull down association 28330616 , (Europe PMC )0.35 IntAct CDK7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CDK8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CERKL Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CHEK2 tandem affinity purification association 23178491 , (Europe PMC )0.35 IntAct COPA Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID COPB2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID COPE Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CPA6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EWSR1 Proximity Label-MS physical 24999758 , (Europe PMC )NA BioGRID FAF1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FBXL17 Affinity Capture-MS physical 27234298 , (Europe PMC )NA BioGRID FBXO38 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GARS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GMPS Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID GRWD1 pull down association 28330616 , (Europe PMC )0.35 IntAct H2AFX Affinity Capture-MS, Affinity Capture-Western physical 18406329 , 28514442 , (Europe PMC )NA BioGRID H2AFY2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HADHA pull down association 28330616 , (Europe PMC )0.35 IntAct HIF1AN anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct HIRIP3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HIST1H2AB proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H2AH proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H2BA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HIST1H2BB Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HIST1H2BD Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HIST1H2BJ proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H2BK proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST1H3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HIST1H4A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HIST2H2AB proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct HIST2H2AC pull down association 28330616 , (Europe PMC )0.35 IntAct HIST3H3 Protein-peptide physical 23281010 , (Europe PMC )NA BioGRID HSPA4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HSPH1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HTR2C pull down association 28330616 , (Europe PMC )0.35 IntAct IFI16 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct ILKAP pull down association 28330616 , (Europe PMC )0.35 IntAct IPO7 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IPO8 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IRF5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct ITGA9 proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct JMJD6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KPNB1 pull down association 28330616 , (Europe PMC )0.35 IntAct KYNU Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID LARP7 pull down association 28330616 , (Europe PMC )0.35 IntAct LMNA Proximity Label-MS physical 22412018 , (Europe PMC )NA BioGRID LRIF1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LRPAP1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct MAP1S pull down association 28330616 , (Europe PMC )0.35 IntAct MAPK11 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MAPK14 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MED4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MSL1 Two-hybrid physical 19650074 , (Europe PMC )NA BioGRID MTNR1B Reconstituted Complex, tandem affinity purification association, physical 17215244 , 26514267 , (Europe PMC )0.53 BioGRID, IntAct NCBP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID NEPRO Affinity Capture-MS physical 26472760 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NSUN2 pull down association 28330616 , (Europe PMC )0.35 IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OAS3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PAIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PARP1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PAWR Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PFDN4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PKN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID POP1 Affinity Capture-MS physical 24778252 , (Europe PMC )NA BioGRID PPAN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PSMA1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PSMC4 pull down association 28330616 , (Europe PMC )0.35 IntAct PSMD2 pull down association 28330616 , (Europe PMC )0.35 IntAct PTK7 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PUF60 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PUS1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PYHIN1 anti tag coimmunoprecipitation association 25665578 , (Europe PMC )0.35 IntAct RBM4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RBM45 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RCC1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RPS3A far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID S100P Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SBK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SHMT2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SLX4 anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SNRNP70 far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct SNRPA far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct SNX12 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SNX3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SPHK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25216046 , 26186194 , (Europe PMC )0.35 BioGRID, IntAct SPR Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRPK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SRPK2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SRXN1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAM Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAT6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STMN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STMN2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SULT1A1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TCEANC2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TERF1 Two-hybrid, bimolecular fluorescence complementation, pull down physical, physical association 21044950 , (Europe PMC )0.51 BioGRID, IntAct TERF2 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TERF2IP Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct TFAM pull down association 28330616 , (Europe PMC )0.35 IntAct TFEB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct THOP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TLE3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TNS2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TP53 anti tag coimmunoprecipitation association 22653443 , (Europe PMC )0.35 IntAct, MINT TP53BP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TPD52L2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRAF6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TROVE2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TTC1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TTC9C Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UBE2C Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UGP2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID USP36 Affinity Capture-MS physical 19615732 , (Europe PMC )NA BioGRID USP36 anti tag coimmunoprecipitation physical association 19615732 , (Europe PMC )0.40 IntAct USP49 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct USP7 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 19615732 , 22361354 , 27880917 , (Europe PMC )0.40 BioGRID, IntAct VPS29 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID VPS52 pull down association 28330616 , (Europe PMC )0.35 IntAct WWP2 Affinity Capture-MS, Affinity Capture-Western physical 25071155 , (Europe PMC )NA BioGRID XPO7 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID XRCC5 anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical association 28330616 , (Europe PMC )0.56 IntAct XRCC6 anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical association 28330616 , (Europe PMC )0.56 IntAct YBX1 far western blotting direct interaction 17572683 , (Europe PMC )0.44 IntAct YEATS4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ZNF223 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF263 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ATM S183_GTGEEPGsQGLNGEA , NA NA PhosphoSitePlus , Unknown S183_GTGEEPGsQGLNGEA , S195_GEAGPEDsTRETPSQ , S201_DSTRETPsQENGPTA , S327_KEEPGSDsGTTAVVA , S517_TAELQPEsGKRKLEE , S527_RKLEEVLsTEGAEEN , S537_GAEENGNsDKKKKAK , T199_PEDSTREtPSQENGP , HTP, in vivo 17287340 , 17525332 , 18077418 , 18669648 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,