Top ALPP
Localization (UniProt annotation) Cell membrane; Lipid-anchor, GPI-anchor Function (UniProt annotation) NA Catalytic Activity (UniProt annotation) A phosphate monoester + H(2)O = an alcohol +phosphate Protein Sequence MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQ
KKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKK
AGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP
DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRL
LSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLA
PGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI
AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-6811438 Intra-Golgi traffic. The mammalian Golgi consists of at least three biochemically distinct cisternae, cis-, medial- and trans (reviewed in Szul and Sztul, 2011; Day et al, 2013). The structure and function of the Golgi are tightly interconnected, such that proteins that are required for protein transport through the Golgi are often also required for the organization of the Golgi stacks, and vice versa (reviewed in Liu and Storrie, 2012; Liu and Storrie, 2015; Chia and Gleeson, 2014; Munro, 2011). Newly synthesized proteins from the ER and ERGIC are received at the cis face of the Golgi and flow through to the trans-Golgi before being released to the trans-Golgi network (TGN) for further secretion to the endolysosomal system, plasma membrane or extracellular region. Retrograde flow from the trans- to cis-cisternae moves endocytosed cargo from the extracellular region, the plasma membrane and the endolysosomal system back towards the ER. Intra-Golgi retrograde traffic also returns resident Golgi proteins to their appropriate cisternae, in this way facilitating cisternal remodeling or maturation (reviewed in Boncompain and Perez, 2013; Day et al, 2013). Intra-Golgi traffic in both directions is mediated by COPI carriers, with specificity of transport being determined at least in part by the complement of SNAREs, RABs and tethering proteins involved (reviewed in Szul and Sztul, 2011; Spang 2013; Willet et al, 2013; Chia and Gleeson, 2014)
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ALPI Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ASPSCR1 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western physical 28049764 , (Europe PMC )NA BioGRID FAF1 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID FAF2 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID KRTAP10-3 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID KRTAP4-12 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KRTAP5-9 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LATS1 Biochemical Activity physical 22641346 , (Europe PMC )NA BioGRID NLGN3 Two-hybrid, two hybrid physical, physical association 25464930 , (Europe PMC )0.37 BioGRID, IntAct NSFL1C Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID PIGK Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11278620 , 12616539 , (Europe PMC )0.40 BioGRID, IntAct, MINT RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-MS physical 29117863 , (Europe PMC )NA BioGRID UBXN1 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID UBXN11 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID UBXN6 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID UBXN7 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source EBI-10171679 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.56 IntAct GPAA1 anti bait coimmunoprecipitation physical association 12616539 , (Europe PMC )0.40 IntAct, MINT KRTAP4-12 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KRTAP5-9 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct NLGN3 Two-hybrid, two hybrid physical, physical association 25464930 , (Europe PMC )0.37 BioGRID, IntAct PIGK Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11278620 , 12616539 , (Europe PMC )0.40 BioGRID, IntAct, MINT SUMO1 affinity chromatography technology association 17000644 , (Europe PMC )0.35 IntAct SUMO3 affinity chromatography technology association 17000644 , (Europe PMC )0.35 IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ALPG Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ALPI Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ASPSCR1 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western physical 28049764 , (Europe PMC )NA BioGRID EBI-10171679 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.56 IntAct FAF1 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID FAF2 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID GPAA1 anti bait coimmunoprecipitation physical association 12616539 , (Europe PMC )0.40 IntAct, MINT KRTAP10-3 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID KRTAP4-12 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct KRTAP5-9 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LATS1 Biochemical Activity physical 22641346 , (Europe PMC )NA BioGRID NLGN3 Two-hybrid, two hybrid physical, physical association 25464930 , (Europe PMC )0.37 BioGRID, IntAct NSFL1C Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID PIGK Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11278620 , 12616539 , (Europe PMC )0.40 BioGRID, IntAct, MINT RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID SUMO1 affinity chromatography technology association 17000644 , (Europe PMC )0.35 IntAct SUMO3 affinity chromatography technology association 17000644 , (Europe PMC )0.35 IntAct TRIM25 Affinity Capture-MS physical 29117863 , (Europe PMC )NA BioGRID UBXN1 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID UBXN11 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID UBXN6 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID UBXN7 Affinity Capture-MS physical 18775313 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown S114_VDKHVPDsGATATAY , S283_MQASLDPsVTHLMGL , T117_HVPDSGAtATAYLCG , T119_PDSGATAtAYLCGVK , T273_ARYVWNRtELMQASL , T314_DPSLMEMtEAALRLL , Y410_KARDRKAyTVLLYGN , Y415_KAYTVLLyGNGPGYV , Y421_LYGNGPGyVLKDGAR , HTP, in vivo 18669648 , 20058876 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
