- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
last maintenance update:
01 Sep, 2023
Top
PPP4C
Gene Name  | PPP4C (QuickGO) | (A quick tutorial to explore the interctive visulaization) |
| Synonyms | PPP4C, PPP4, PPX | |
| Protein Name | PPP4C |
|
| Alternative Name(s) |
Serine/threonine-protein phosphatase 4 catalytic subunit;PP4C;Pp4;3.1.3.16;Protein phosphatase X;PP-X; | |
| EntrezGene ID | 5531 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P60510 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 (BRENDA ) | |
| Molecular Weight | 35080 Dalton | |
| Protein Length | 307 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000149923 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: PPPL --> Family: PPP | Historic class: PSTPs --> PPP --> PP4 | CATH ID: 3.60.21.10 | SCOP Fold: PPPL | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Cytoplasm, cytoskeleton,microtubule organizing center, centrosome | |||
| Function (UniProt annotation) | |||
| Protein phosphatase that is involved in many processessuch as microtubule organization at centrosomes, maturation ofspliceosomal snRNPs, apoptosis, DNA repair, tumor necrosis factor(TNF)-alpha signaling, activation of c-Jun N-terminal kinaseMAPK8, regulation of histone acetylation, DNA damage checkpointsignaling, NF-kappa-B activation and cell migration The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation andregulation of HDAC3 The PPP4C-PPP4R2-PPP4R3A PP4 complexspecifically dephosphorylates H2AFX phosphorylated on Ser-140(gamma-H2AFX) generated during DNA replication and required forDNA double strand break repair Dephosphorylates NDEL1 at CDK1phosphorylation sites and negatively regulates CDK1 activity ininterphase (By similarity) In response to DNA damage, catalyzesRPA2 dephosphorylation, an essential step for DNA repair since itallows the efficient RPA2-mediated recruitment of RAD51 tochromatin | |||
| Catalytic Activity (UniProt annotation) | |||
| [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFM GDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKI FCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004704 | F:NF-kappaB-inducing kinase activity |
| GO:0004722 | F:protein serine/threonine phosphatase activity |
| GO:0005634 | C:nucleus |
| GO:0005654 | C:nucleoplasm |
| GO:0005815 | C:microtubule organizing center |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0010569 | P:regulation of double-strand break repair via homologous recombination |
| GO:0030289 | C:protein phosphatase 4 complex |
| GO:0046872 | F:metal ion binding |
Download FASTA sequences of PPP4C-substrates in Humans
| Substrate Gene Name | Substrate UniProt_AC | DephosphoSite and sequence (+/-5) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| H2AFX | P16104 | Ser-140 _KATQAsQEY-- | In vitro and in vivo | 18758438, 18614045, | Europe PMC |  |
| RPA2 | P15927 | NA | In vitro and in vivo | 20154705, | Europe PMC | |
| NDEL1 | Q9GZM8 | Thr-219_LSLPAtPVGKG | In vitro and in vivo | 18347064, | Europe PMC | |
| HDAC3 | O15379 | Ser-424_DNDKEsDVEI- | In vivo | 15805470, | Europe PMC | |
| RELA | Q04206 | Thr-435_QAGEGtLSEAL | In vivo | 15073167, | Europe PMC | |
| CCAR2 | Q8N163 | Thr-454_EAAPPtQEAQG | in vitro | 26194823, | Europe PMC | |
| MAP4K1 | Q92918 | NA | In vivo | 15364934, | Europe PMC | |
[Feedback|Contribution]
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04922 | Glucagon signaling pathway | Glucagon is conventionally regarded as a counterregulatory hormone for insulin and plays a critical anti-hypoglycemic role by maintaining glucose homeostasis in both animals and humans. To increase blood glucose, glucagon promotes hepatic glucose output by increasing glycogenolysis and gluconeogenesis and by decreasing glycogenesis and glycolysis in a concerted fashion via multiple mechanisms. Glucagon also stimulates hepatic mitochondrial beta-oxidation to supply energy for glucose production. Glucagon performs its main effect via activation of adenylate cyclase. The adenylate-cyclase-derived cAMP activates protein kinase A (PKA), which then phosphorylates downstream targets, such as cAMP response element binding protein (CREB) and the bifunctional enzyme 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase (one of the isoforms being PFK/FBPase 1, encoded by PFKFB1). |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-5693607 | Processing of DNA double-strand break ends. | Homology directed repair (HDR) through homologous recombination (HRR) or single strand annealing (SSA) requires extensive resection of DNA double strand break (DSB) ends (Thompson and Limoli 2003, Ciccia and Elledge 2010). The resection is performed in a two-step process, where the MRN complex (MRE11A:RAD50:NBN) and RBBP8 (CtIP) bound to BRCA1 initiate the resection. This step is regulated by the complex of CDK2 and CCNA (cyclin A), ensuring the initiation of HRR during S and G2 phases of the cell cycle, when sister chromatids are available. The initial resection is also regulated by ATM-mediated phosphorylation of RBBP8 and CHEK2-mediated phosphorylation of BRCA1 (Chen et al. 2008, Yun and Hiom 2009, Buis et al. 2012, Wang et al. 2013, Davies et al. 2015, Parameswaran et al. 2015). After the initial resection, DNA nucleases EXO1 and/or DNA2 perform long-range resection, which is facilitated by DNA helicases BLM or WRN, as well as BRIP1 (BACH1) (Chen et al. 2008, Nimonkar et al. 2011, Sturzenegger et al. 2014, Suhasini et al. 2011). The resulting long 3'-ssDNA overhangs are coated by the RPA heterotrimers (RPA1:RPA2:RPA3), which recruit ATR:ATRIP complexes to DNA DSBs and, in collaboration with RAD17:RFC and RAD9:HUS1:RAD1 complexes, and TOPBP1 and RHNO1, activate ATR signaling. Activated ATR phosphorylates RPA2 and activates CHEK1 (Cotta-Ramusino et al. 2011), both of which are necessary prerequisites for the subsequent steps in HRR and SSA |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ATAD3B | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| BAG6 | Affinity Capture-MS, Co-fractionation | physical | 17353931, 22863883, (Europe PMC) | NA | BioGRID |
| BCAS2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CCDC6 | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 18715871, 19156129, 27880917, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| CCT2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT3 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT4 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT5 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT6A | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT6P1 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| CCT7 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT8 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CLASP2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| DHX38 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 18715871, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DYNLT1 | Proximity Label-MS | physical | 26638075, (Europe PMC) | NA | BioGRID |
| EEF1A1 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| GEMIN4 | Affinity Capture-Western | physical | 12668731, (Europe PMC) | NA | BioGRID |
| GLYATL3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19156129, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDAC3 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down | physical, physical association | 15805470, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| IGBP1 | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 16085932, 16769727, 18614045, 18715871, 19156129, 26496610, 27880917, 9647778, , (Europe PMC) | 0.93 | BioGRID, IntAct |
| IKBKG | Affinity Capture-Western, Co-localization | physical | 24109239, (Europe PMC) | NA | BioGRID |
| JUN | Reconstituted Complex | physical | 9837938, (Europe PMC) | NA | BioGRID |
| LCMT1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| MAP4K1 | Affinity Capture-Western, Biochemical Activity | physical | 15364934, 24362026, (Europe PMC) | NA | BioGRID |
| NFKB1 | Affinity Capture-Western | physical | 9837938, (Europe PMC) | NA | BioGRID |
| PLOD3 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| PPME1 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| PPP2CA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2CB | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 26496610, 27880917, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PPP2R1A | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical, physical association | 17353931, 18715871, 19156129, 27880917, 28330616, (Europe PMC) | 0.80 | BioGRID, IntAct |
| PPP2R2A | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PPP2R2B | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 19156129, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| PPP2R2D | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 19156129, 28330616, 28514442, (Europe PMC) | 0.60 | BioGRID, IntAct |
| PPP2R5D | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 18715871, 19156129, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP4R1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 16085932, 17353931, 18614045, 18715871, 19156129, 26496610, 27880917, (Europe PMC) | 0.35, 0.86 | BioGRID, IntAct |
| PPP4R2 | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification | association, physical, physical association | 10769191, 12668731, 16085932, 17353931, 18614045, 18715871, 19156129, 20876121, 26344197, 26496610, 27880917, 28330616, 28514442, (Europe PMC) | 0.93 | BioGRID, IntAct |
| PPP4R3A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 16085932, 17353931, 18715871, 19156129, 20876121, 21423269, 26496610, 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| PPP4R3B | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation | physical | 16085932, 17353931, 18715871, 19156129, 20876121, 26344197, 27880917, (Europe PMC) | NA | BioGRID |
| PPP4R4 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 18715871, 19156129, 27880917, 28514442, (Europe PMC) | 0.35, 0.50 | BioGRID, IntAct |
| PRPF19 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PTPA | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| REL | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 9837938, (Europe PMC) | NA | BioGRID |
| RELA | Reconstituted Complex | physical | 9837938, (Europe PMC) | NA | BioGRID |
| RNGTT | Affinity Capture-MS | physical | 27432908, 27880917, (Europe PMC) | NA | BioGRID |
| SLC25A31 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| SMN1 | Affinity Capture-Western | physical | 12668731, (Europe PMC) | NA | BioGRID |
| SRRM2 | Affinity Capture-MS | physical | 16159877, (Europe PMC) | NA | BioGRID |
| SUPT5H | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TCP1 | Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, 22863883, (Europe PMC) | 0.64 | BioGRID, IntAct |
| TIPRL | Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, direct interaction, physical, physical association | 16085932, 17353931, 17384681, 18614045, 27880917, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| TK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TLR4 | Affinity Capture-Western | physical | 18634786, (Europe PMC) | NA | BioGRID |
| TP53 | Reconstituted Complex | physical | 9837938, (Europe PMC) | NA | BioGRID |
| TRAF6 | Affinity Capture-Western, Two-hybrid | physical | 18634786, (Europe PMC) | NA | BioGRID |
| TRIM28 | Affinity Capture-Western, Biochemical Activity | physical | 22491012, (Europe PMC) | NA | BioGRID |
| TRMT1L | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| TUBA3C | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| UBXN10 | Affinity Capture-MS | physical | 26389662, (Europe PMC) | NA | BioGRID |
| WDR81 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CALML5 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CCDC6 | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 18715871, 19156129, 27880917, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| CCT2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT3 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT4 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT5 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT6A | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT7 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT8 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CDC45 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DHX38 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 18715871, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DSP | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DYNC1H1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EBI-1058599 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| GLYATL3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19156129, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDAC3 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down | physical, physical association | 15805470, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| IGBP1 | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 16085932, 16769727, 18614045, 18715871, 19156129, 26496610, 27880917, 9647778, , (Europe PMC) | 0.93 | BioGRID, IntAct |
| IKBKE | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| MYO1D | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PPM1D | anti bait coimmunoprecipitation | physical association | 18614045, (Europe PMC) | 0.40 | IntAct |
| PPP2CA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2CB | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 26496610, 27880917, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PPP2R1A | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical, physical association | 17353931, 18715871, 19156129, 27880917, 28330616, (Europe PMC) | 0.80 | BioGRID, IntAct |
| PPP2R2B | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 19156129, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| PPP2R2D | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 19156129, 28330616, 28514442, (Europe PMC) | 0.60 | BioGRID, IntAct |
| PPP2R5D | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 18715871, 19156129, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP4R1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 16085932, 17353931, 18614045, 18715871, 19156129, 26496610, 27880917, (Europe PMC) | 0.35, 0.86 | BioGRID, IntAct |
| PPP4R2 | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification | association, physical, physical association | 10769191, 12668731, 16085932, 17353931, 18614045, 18715871, 19156129, 20876121, 26344197, 26496610, 27880917, 28330616, 28514442, (Europe PMC) | 0.93 | BioGRID, IntAct |
| PPP4R3A | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical association | 16085932, 17353931, 18614045, 18715871, 19156129, 26496610, (Europe PMC) | 0.35, 0.82 | IntAct |
| PPP4R3B | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical association | 16085932, 17353931, 18614045, 18715871, 19156129, (Europe PMC) | 0.35, 0.74 | IntAct |
| PPP4R4 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 18715871, 19156129, 27880917, 28514442, (Europe PMC) | 0.35, 0.50 | BioGRID, IntAct |
| PPP6C | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| RPAP1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TCP1 | Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, 22863883, (Europe PMC) | 0.64 | BioGRID, IntAct |
| TCTE1 | proximity-dependent biotin identification | association | 26638075, (Europe PMC) | 0.35 | IntAct |
| TIPRL | Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, direct interaction, physical, physical association | 16085932, 17353931, 17384681, 18614045, 27880917, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| TK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TTC34 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| TIPRL | Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, direct interaction, physical, physical association | 16085932, 17353931, 17384681, 18614045, 27880917, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| TK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ATAD3B | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| BAG6 | Affinity Capture-MS, Co-fractionation | physical | 17353931, 22863883, (Europe PMC) | NA | BioGRID |
| BAG6 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| BCAS2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CALML5 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CAND1 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CCDC6 | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 18715871, 19156129, 27880917, 28514442, (Europe PMC) | 0.67 | BioGRID, IntAct |
| CCT2 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT3 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT4 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT5 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT6A | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT6P1 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| CCT7 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CCT8 | Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, (Europe PMC) | 0.64 | BioGRID, IntAct |
| CDC45 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| CDC5L | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CLASP2 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| CUL3 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| DHX38 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 18715871, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DSP | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DYNC1H1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| DYNLT1 | Proximity Label-MS | physical | 26638075, (Europe PMC) | NA | BioGRID |
| EBI-1058599 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| EEF1A1 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| ELAVL1 | Affinity Capture-RNA | physical | 19322201, (Europe PMC) | NA | BioGRID |
| GEMIN4 | Affinity Capture-Western | physical | 12668731, (Europe PMC) | NA | BioGRID |
| GLYATL3 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 19156129, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HDAC3 | Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down | physical, physical association | 15805470, (Europe PMC) | 0.52 | BioGRID, IntAct, MINT |
| HNRNPL | Affinity Capture-RNA | physical | 28611215, (Europe PMC) | NA | BioGRID |
| IGBP1 | Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach | association, physical, physical association | 16085932, 16769727, 18614045, 18715871, 19156129, 26496610, 27880917, 9647778, , (Europe PMC) | 0.93 | BioGRID, IntAct |
| IKBKE | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| IKBKG | Affinity Capture-Western, Co-localization | physical | 24109239, (Europe PMC) | NA | BioGRID |
| JUN | Reconstituted Complex | physical | 9837938, (Europe PMC) | NA | BioGRID |
| KSR1 | anti tag coimmunoprecipitation | association | 27086506, (Europe PMC) | 0.35 | IntAct |
| LCMT1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| MAP4K1 | Affinity Capture-Western, Biochemical Activity | physical | 15364934, 24362026, (Europe PMC) | NA | BioGRID |
| MYO1D | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| NFKB1 | Affinity Capture-Western | physical | 9837938, (Europe PMC) | NA | BioGRID |
| PLOD3 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| PPM1D | anti bait coimmunoprecipitation | physical association | 18614045, (Europe PMC) | 0.40 | IntAct |
| PPME1 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| PPP2CA | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP2CB | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | association, physical, physical association | 17353931, 26496610, 27880917, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PPP2R1A | Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical, physical association | 17353931, 18715871, 19156129, 27880917, 28330616, (Europe PMC) | 0.80 | BioGRID, IntAct |
| PPP2R2A | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PPP2R2B | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 19156129, 28330616, (Europe PMC) | 0.46 | BioGRID, IntAct |
| PPP2R2D | Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down | association, physical | 19156129, 28330616, 28514442, (Europe PMC) | 0.60 | BioGRID, IntAct |
| PPP2R5D | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 18715871, 19156129, 27880917, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPP4R1 | Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical, physical association | 16085932, 17353931, 18614045, 18715871, 19156129, 26496610, 27880917, (Europe PMC) | 0.35, 0.86 | BioGRID, IntAct |
| PPP4R2 | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, tandem affinity purification | association, physical, physical association | 10769191, 12668731, 16085932, 17353931, 18614045, 18715871, 19156129, 20876121, 26344197, 26496610, 27880917, 28330616, 28514442, (Europe PMC) | 0.93 | BioGRID, IntAct |
| PPP4R3A | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex | physical | 16085932, 17353931, 18715871, 19156129, 20876121, 21423269, 26496610, 27880917, 28514442, (Europe PMC) | NA | BioGRID |
| PPP4R3A | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical association | 16085932, 17353931, 18614045, 18715871, 19156129, 26496610, (Europe PMC) | 0.35, 0.82 | IntAct |
| PPP4R3B | Affinity Capture-MS, Affinity Capture-Western, Co-fractionation | physical | 16085932, 17353931, 18715871, 19156129, 20876121, 26344197, 27880917, (Europe PMC) | NA | BioGRID |
| PPP4R3B | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical association | 16085932, 17353931, 18614045, 18715871, 19156129, (Europe PMC) | 0.35, 0.74 | IntAct |
| PPP4R4 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation | association, physical, physical association | 18715871, 19156129, 27880917, 28514442, (Europe PMC) | 0.35, 0.50 | BioGRID, IntAct |
| PPP6C | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| PRPF19 | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| PTPA | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| REL | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 9837938, (Europe PMC) | NA | BioGRID |
| RELA | Reconstituted Complex | physical | 9837938, (Europe PMC) | NA | BioGRID |
| RNGTT | Affinity Capture-MS | physical | 27432908, 27880917, (Europe PMC) | NA | BioGRID |
| RPAP1 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| SLC25A31 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| SMN1 | Affinity Capture-Western | physical | 12668731, (Europe PMC) | NA | BioGRID |
| SRRM2 | Affinity Capture-MS | physical | 16159877, (Europe PMC) | NA | BioGRID |
| SUPT5H | Affinity Capture-MS | physical | 27880917, (Europe PMC) | NA | BioGRID |
| TCP1 | Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, tandem affinity purification | association, physical | 16085932, 18715871, 19156129, 22863883, (Europe PMC) | 0.64 | BioGRID, IntAct |
| TCTE1 | proximity-dependent biotin identification | association | 26638075, (Europe PMC) | 0.35 | IntAct |
| TIPRL | Affinity Capture-MS, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification | association, direct interaction, physical, physical association | 16085932, 17353931, 17384681, 18614045, 27880917, (Europe PMC) | 0.80 | BioGRID, IntAct, MINT |
| TK1 | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TLR4 | Affinity Capture-Western | physical | 18634786, (Europe PMC) | NA | BioGRID |
| TP53 | Reconstituted Complex | physical | 9837938, (Europe PMC) | NA | BioGRID |
| TRAF6 | Affinity Capture-Western, Two-hybrid | physical | 18634786, (Europe PMC) | NA | BioGRID |
| TRIM28 | Affinity Capture-Western, Biochemical Activity | physical | 22491012, (Europe PMC) | NA | BioGRID |
| TRMT1L | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| TTC34 | anti bait coimmunoprecipitation | physical association | 17353931, (Europe PMC) | 0.40 | IntAct |
| TUBA3C | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| UBXN10 | Affinity Capture-MS | physical | 26389662, (Europe PMC) | NA | BioGRID |
| WDR81 | Affinity Capture-MS | physical | 19156129, (Europe PMC) | NA | BioGRID |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
[Feedback|Contribution]